HOG Organism Gene ID Name Annotation
aHOG0847 hhi 1179 gyrB DNA gyrase subunit B
>1179|gene|hhi DNA gyrase subunit B [Haloarcula hispanica ATCC 33960]
MSGESDEYGAKSIQTLEGLEAVQKRPAMYIGSTDARGLHHLVYEVVDNAIDEALAGYCDN
IDVTIHDDGSVSVSDDGRGIPVDTHEEHGRPAVEVVMTILHAGGKFDNKSYQVSGGLHGV
GVSVVNALSKWLEVEVRRDGALWKQRFDHGKPEYDLKKVRDLEPDEETGTTVRFWPDDEI
FETGEFKFSTLSSRLRELAFLNSGVAISIIDERDGETETFAYDGGIREFVEYLNETKDPL
HRDIIYFEDEEEIAEGPVQVEIAMQGTDDLQGSIHAFANNINTREGGTHLTGFKTSLTRV
VNDYATDNNLLKDLDDTLKGDDIREGLTAVISVKHPDPQFEGQTKTKLGNSEVRGIVESA
MHDGLATFFEENPDTAEAIVGKAVEAAKARKAAQKAEELTRRKSALDSTALPGKLADCQT
RDPEEAELFIAEGDSAGGSAKQGRNPDFQAILPIKGKILNVEKHRLDRILENNEIRNLIT
ALGTGIGDEFDIDDLRYEKIILMTDADVDGAHIRTLLLTLFYRHMKPLLEAGYVYASQPP
LYRIRYRGNTYDAMTDAERDKIIEEKCDGNPTHVQRFKGLGEMNPEQLWETTMNPDNRIL
KQITIEDAAAADKMFNILMGDAVEPRKEFIKENSPEAEWVDI