HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0084COG1131arCOG00194ABC-type multidrug transport system ATPase componentputative ABC transporter.ATP-binding subunit

HOG Organism Gene ID Name Annotation
cHOG0084 nrc1 VNG0668 trp8 putative ABC transporter.ATP-binding subunit
cHOG0084 hmu HMUK2802 Hmuk_2802 ABC transporter related
cHOG0084 hma RRNAC0048 ABC transporter ATP-binding protein
cHOG0084 hwa HQ1493A abcA ABC-type transport system ATP-binding protein
cHOG0084 hla HLAC0326 Hlac_326 ABC transporter related
cHOG0084 hbo HBOR21850 Hbor_21850 ABC-type multidrug transport system, ATPase component
cHOG0084 hut HUTA2485 Huta_2485 ABC transporter related
cHOG0084 hvo HVO_1006 HVO_1006 nosF ABC transporter ATP-binding protein
cHOG0084 nph NP2442A abc28a ABC-type transport system ATP-binding protein
cHOG0084 hhi 807 drrA ABC transporter ATP-binding protein
MUSCLE (3.6) multiple sequence alignment


1493|gene|hwa       ----------------------------MTAALVAENVYKSYGDVRALDGVSLSVDAGEM
668|chp|nrc1        ----------------------------MDSVLVADDVAKSYGDAAALRGVSLSVSEGEV
2485|gene|hut       -----------------------------MTAIAIDDVRRTYGDTVALDAVSLSVDPGEI
326|gene|hla        MNETTAADVDAADDATRGRDAAGADAADPDAVVVGEGVRKSYGDVVALDGVDIRVESGEV
21850|gene|hbo      ----------------------------MDEVLVADDVRKSYGDRDALSGVSLSVSAGEV
2442|gene|nph       ------------------------------MVIRASDVRRQYGETVALDGVSLSVDAGEV
10048|gene|hma      ----------------------------MDEVLVASDVGRRYGDTVALDGVSLTATTGEV
807|gene|hhi        ----------------------------MDEVLVASDVGRRYGDTVALDGVSLTATAGEV
                                                   .:  ..* . **:  ** .*.: .  **:

1493|gene|hwa       FGLVGPNGAGKTTLVRALTGTTTVR-GQLSIRGVTPTKLDKSQVGVLPQSFTPPGRLTAH
668|chp|nrc1        FALVGPNGAGKTTLVRCLTGTTTPDGGRVELLGEPPQDAQKQRLGLLPQSFSPPDRLTAA
2485|gene|hut       FGLVGPNGAGKTTLARAITGTTDYD-GTVALFGEQPRAIDRSRLGSLPQSFSPHERLTAR
326|gene|hla        FGLIGPNGAGKTTLVRALTGTTEAE-GDLRVFGVPPREVDPQRIGLLPQSFDPPERLTAT
21850|gene|hbo      FGLIGPNGAGKTTLVRALTGTTPVE-GHVSVLGTSPTAVERSRIGLLPQSFSPAARLTAR
2442|gene|nph       FALIGPNGAGKTTLIRALTGTTAAE-GDISVFGESPESVARHRIGLLPQEFTPAERLTAR
10048|gene|hma      LALVGPNGAGKTTLVRALTGTTDAT-GEVTLFGQSPRTVARDRIGLLPQSFAPHERLTAR
807|gene|hhi        LALVGPNGAGKTTLVRALTGTTDAT-GEVRLFSQSPRTVARDRIGLLPQSFSPHERLTAR
                    :.*:********** *.:****    * : : .  *      .:* ***.* *  **** 

1493|gene|hwa       ELIEYYAGLYEDTRDPATVLDDVGLSGDSTTQWYETLSGGQQRRVCVAIALINDPAVLFL
668|chp|nrc1        ELVGYYAGLYADSRAPDAVLESVGLD-PDDATRYGDLSGGQRRRACVAAALVNDPDVLFL
2485|gene|hut       ELLEYYAGLYDDALTPGRVLDDVGLI-DSADTYYENLSGGQQRRVCVGSALVNDPDLLVL
326|gene|hla        ELVGYYGGLYDAARDAESVLRDVGMA-DDADVWYETLSGGQKRRTCVATAIVNDPDLLFL
21850|gene|hbo      ELVSYYAGLYDEARDPESVLADVGLAGDDANTWYEDLSGGQQRRACVAAALVNDPDVLFL
2442|gene|nph       ELIDYYGGLYDETRDTDAILDDVGLT-DSAATAYENLSGGQKRRACVGTTLVNDPDLLIL
10048|gene|hma      ELLEYYAGLYDDTRDVEAVLDDVGLA-DTASTTYENLSGGQQRRTCVATALINDPDLLVL
807|gene|hhi        ELLEYYAGLYDDTRDVEAVLDDVGLT-DTASTTYENLSGGQQRRACVATALINDPDLLVL
                    **: **.***  :     :* .**:        *  *****.**.**. :::*** :*.*

1493|gene|hwa       DEPTTGIDPAGRRSLWSLLETLAAGGTTVFLTSHSMTEVERLADRVGFLNDGQLLTIGDP
668|chp|nrc1        DEPTTGVDPAGRHALWSVFEGLAADGTTIVLTTHDMAEASALADRVGLLADGDIAATGTP
2485|gene|hut       DEPTTGIDPAGRRQLWDLLEGLAADGTTIFLTTHDMHEAERLANRVGLLADGELVAVDTP
326|gene|hla        DEPTTGIDPAGRRSIHRLIERLAGGGTTVFLTSHAMDEVERLADRVALLRDGKIVAVGAP
21850|gene|hbo      DEPTTGIDPAGRRSLWNLLDDLAAGGTTVFLTSHSMAEVERLADRVGLLNAGELVAVGSP
2442|gene|nph       DEPTTGIDPRGRRDLWRLIEGLAEGGTTVLLTTHYMAEAEELADRVGMLADGELIALGTP
10048|gene|hma      DEPTTGIDPAGRRDLWRLLEGLADRGVTILVTTHYMEEAQRLADRVGLLADGTLIALDSP
807|gene|hhi        DEPTTGIDPAGRRDLWRLLEGLADRGVTILVTTHYMEEAQRLADRVGLLADGTLIALDSP
                    ******:** **. :. ::: **  *.*:.:*:* * *.. **:**.:*  * : : . *

1493|gene|hwa       QSLIDTHAGENKLIIETETALDSTAFSSLSFDIQTSVSGT----------------RTVV
668|chp|nrc1        ADLVAAHAGSPRLVVDTDADPELAGFDCTRTDA-----------------------GLVF
2485|gene|hut       RALIDAHGGESRLTVETASPLAEVDASGLDYRA--AIVDN----------------DLRV
326|gene|hla        EELIADHGGEPRLEVKLDGPASEADCEAVQEAIREALSDESAGESEDAPAVESTRKGLRI
21850|gene|hbo      SELVAAHGGDSRLEVETES-LPESATEALNGHFDAAARDG----------------RLVF
2442|gene|nph       SELVERHGGDSRLVV--EADDGTAAKTALRDAGYELLPDE----------------RHVA
10048|gene|hma      DQLVAEHGGDSQLIV--DGSFDEAAVSAIDYPAETALRNG----------------RLVV
807|gene|hhi        DQLVVEHGGDSQLIV--DGTFDEAAVSAIDYPAETAIRNG----------------RLVV
                      *:  *.*. .* :                                             

1493|gene|hwa       KSVGPRDIGDIIDAVDMTTVTVESLTWKQPDLEDVYLALAGETLNPSRTT-KTSNSNEDT
668|chp|nrc1        EGVDPTAVGEIAAALDDADVAFDALSWREPSLEDAYLALAGDA--ERG------------
2485|gene|hut       FDVAPTEIGTVVDSLTDAGVQVESLSWAEPTLEDVYLELTGTAVGRGGQRLDDGAASAAE
326|gene|hla        GGVRPEGIGDAVDALETAEIDFESLAWSEPSLEDVYLRLTGEEYSPRS------------
21850|gene|hbo      EGLTPRDIGDAVDALDDAGIAYDTLTWTQPDLEDVYLSLTGEAFEDNP------------
2442|gene|nph       VPAGPREIPSVVEALDDAGADYEGLVWRQPSLDDVYVALTGTDVAAGG------------
10048|gene|hma      YGIRPESIGNITEQLGQAGIEYDSLTWKQPDLEDVYLELTGTAVGQRG------------
807|gene|hhi        YGIRPESIGNITEQLGQAGIEYDSLTWKQPDLEDVYLELTGTAVGQRG------------
                        *  :      :  :    : * * :* *:*.*: *:*                   

1493|gene|hwa       APRIDDVNTGGNVMSQTAITTTTEESDQ---
668|chp|nrc1        -----EVVQ----------------------
2485|gene|hut       EPNAPTPPTEGSS------------------
326|gene|hla        EPLDEVAPDGGDR------------------
21850|gene|hbo      SFADAPMADGGGNVGQSARGGHGGSRGGDEQ
2442|gene|nph       -----EPVTEASP------------------
10048|gene|hma      EPQQTEPVAGGAQ------------------
807|gene|hhi        EPRRTEPAAGGVQ------------------