HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0082COG1199KOG1133 KOG1131 KOG1132arCOG00770Rad3-related DNA helicaseshelicase

HOG Organism Gene ID Name Annotation
cHOG0082 nrc1 VNG1383 rad3a helicase
cHOG0082 hmu HMUK2975 Hmuk_2975 helicase c2( EC:3.6.1.- )
cHOG0082 hma RRNAC0680 rad3a helicase
cHOG0082 hwa HQ1981A rad3 DNA repair helicase Rad3
cHOG0082 hla HLAC0816 Hlac_816 helicase c2
cHOG0082 hla HLAC1431 Hlac_1431 hypothetical protein
cHOG0082 hbo HBOR18810 Hbor_18810 DNA helicase, Rad3-like( EC:3.6.1.- )
cHOG0082 hut HUTA2465 Huta_2465 helicase c2
cHOG0082 hvo HVO_1351 HVO_1351 rad3a helicase
cHOG0082 nph NP0960A rad3a DNA repair helicase
cHOG0082 hhi 1333 rad3a helicase
MUSCLE (3.6) multiple sequence alignment


1981|gene|hwa       -----MCTDTVSDIDAGWTPYFRYDTIYADQRAAIESFLDTLGEQGYYLKEGACGTGKTL
1431|hp|hla         -----MSAPT-----P---------------------AVHAVRSASFY------------
960|gene|nph        MSLGEAASPPFVSSAPDWRPIFGHDDPYDDQRDGIETAIETAADDGFLALEGACGTGKTM
816|gene|hla        -----MTDAP-----P-WTDLFGHAEPYPEQADGIDAAIDAAEDGGFLALEGACGTGKTM
18810|gene|hbo      -----MTTAAGVKSVN-WQAVFGHPEPYPEQADGIEAAIDAAEDDGFLVVEGACGTGKTM
1383|gene|nrc1      -----MGDADE----P-WREFFGFEAPYDQQADAIGAAIEAGDSDGFLAMEGPCGTGKTM
2465|gene|hut       -----MGTREETDA-T-WQELFGFGQPYDDQADAIEAAIAAGRRQGFLAMEGPCGTGKTM
10680|gene|hma      -----MGDPASTGTES-WRTYFGFDEPYENQADAVERAIEAGKARGFLAMEGPCGTGKTM
1333|gene|hhi       -----MADPASTGTES-WRTYFGFDEPYENQADAVERAIEAGKARGFLAMEGPCGTGKTM
                                                          : :    .:             

1981|gene|hwa       AAITASIHAIRNPKQLNDRSPTNASAPEYDRVIAVTPVKKQLQQFIAELRGINATLPAET
1431|hp|hla         ------------------------------------------------------------
960|gene|nph        LALTAGIHLVRDPDS------------SFERVFVLTSVKQQLRQFEADIRTINGNLPDDW
816|gene|hla        LALTAGLDRVRDPDS------------DFERVFVLTSVKQQLRQFETDLETINGDLPDGY
18810|gene|hbo      LALTAGIDRVRDPDS------------DYERVFVLTSVKQQLRQFEKDLRTINENLPEDW
1383|gene|nrc1      AALTAGAHLVRNTDS-------------YERVLVVTPVKQQLEQFVADLRTMNAGLDD--
2465|gene|hut       AALTAGATLVREDE--------------YERVLVVTPVKQQRRQFVADLRQLNAGLDE--
10680|gene|hma      AALTAGATLVRDTDL-------------YERMVVVTPVKQQLQQFVDDLRALNAGIDE--
1333|gene|hhi       AALTAGATLVRDTDL-------------YERMVVVTPVKQQLQQFVDDLRTLNAGIEE--
                                                                                

1981|gene|hwa       DPIQTVVLRGQADMMAIRNAEL---PKTDTQEATQDLRATTREVIRFNSDIPLDWPDNLS
1431|hp|hla         -----VSLT---------------------------------------------------
960|gene|nph        HPVSALTLVGKADVCPYNLAGAGGIDDTNVYERCEGLRERTRGL----TDEATTAGSLAQ
816|gene|hla        DPVSGLTLVGKADVCPYARENRGGIDRENVYERCEGLRERTRNLVG--DGGATTTSNLVS
18810|gene|hbo      NPVSGLTLVGKSDVCPYSRENVAGIDDTTVYDRCEGLRERTRNLVG--DGGLTSTGKLVK
1383|gene|nrc1      -PLDGVALVGKRDLCPYEREDKFP-DDAGVHERCEDLRESTAGLVEGDDGGEFDGQDARD
2465|gene|hut       -PLAGIALVGKRDLCPYGREDVFP-PDASVHDRCEELRENTADLVE--SDGSSDDRPVAD
10680|gene|hma      -PFDGISLVGKRDLCPYGRESQFP-DDVGTHDRCEDLREATARLVE--DDGRSDGAAVAD
1333|gene|hhi       -PFDGISLVGKRDLCPYGREGQFP-DDVSTHDRCEDLREATARLVE--DGGRSDGAAVAD
                         : *                                                    

1981|gene|hwa       ---PPAYSMAEYDWSTPSEGAVQAQENHQYDPNRAEAIRHIVAQLEPRDTESNAQLCIDG
1431|hp|hla         ------------------------------------------------------------
960|gene|nph        --QARSQQVG--------------LGDSAGEAS---------------------YLEAAG
816|gene|hla        --EAQSQQVG-----------LLDSGNRGGSAT--------------GDSSAADYLSVDG
18810|gene|hbo      --EARAAQTG-----------LLDTGSSGGGPT---------------------YLETAG
1383|gene|nrc1      LTELPAAETPDEPWWDPAAGRALARSARADA----------------SQTLSQTPLRTAG
2465|gene|hut       ---AVIRPRNDDIWWDPQTGSDLAKAARPGGV---------------GQQAVAGTLTTAG
10680|gene|hma      --AAIAGEADDDQWWDPRKGQDLAAAARPDAVE--------------QSTLGDDTLQTAG
1333|gene|hhi       --AAIAGETDDDQWWDPRKGQDLAAAARPDAAD--------------QATLGDNTLSTAG
                                                                                

1981|gene|hwa       IETPYPQHVPHTSEIVDSTRLDSNYNQLPSDLQGRFDPFYAATLAGLQES--IVE---FA
1431|hp|hla         ---PFR-----------------------------------------PRDGDAIE-----
960|gene|nph        EPTPYP------PEMPAAGDADVEFC-----------PFYAGFLDDLPEDGDPIEAVPFD
816|gene|hla        DPTPYR------PDTEEF--EGTEFC-----------PFYAGFLDDLPEDGDPAEAVPFD
18810|gene|hbo      EPTPYL------PETTEY--EDTEYC-----------PFYATFLDDLPEDGDPIEAVPFD
1383|gene|nrc1      TDAPYVPHQPTAPEDMADG-DPPLMC-----------PFEADWYG--RDKGSPVG---FE
2465|gene|hut       TESPYRRTQPTAPDEIG-GEDPPLYC-----------PFEADWFA--RNKGSPIG---FA
10680|gene|hma      AASPYRQAQPTAPESMAEGSDPPLYC-----------PFEADWYA--RNKGSPVD---FS
1333|gene|hhi       ANSPYRQAQPTAPESMADGSDPPLYC-----------PFEADWYA--RNKGSPVD---FS
                       *:                                            .          

1981|gene|hwa       DAPSHVIDKQTLFEATVASGCCPHELMCILAQQADVIIGNYNHLLDPETRY-LTDRKLGL
1431|hp|hla         ------------------------------------------------------------
960|gene|nph        PTDRGLIETDDLVELSASRGSCPHSVMGALLPNVEILVGNYYHAFDPTTVEAFTG---GL
816|gene|hla        VTELGHVGPTELVRLAAGHGTCPHSIMGALVPEVEVVIGNYYHAFDPVTTGTFTG---AL
18810|gene|hbo      VTELGLVDTEELVRLSAGYGTCPHSVMGAVLPHVEVVVGNYYHAFDPTTVGSFTG---AL
1383|gene|nrc1      TGQHNVVTSADVLPAGVDHGTCPHRVQQVLLDHAEVVVGNYNHLFDPQTRG-LTD---HL
2465|gene|hut       AGEDSVVTAAEYLPGAVERGTCPHRAMQTLVGAAAVVIGNYNHLFDPASRA-LIE---PI
10680|gene|hma      AGDEHVVTMDDYLPAATERGTCPHRVMSVMLNEADVIVGNYNHLFDPGSRP-LLS---DV
1333|gene|hhi       AGEEHVVTMDDYLPAATERGTCPHRVMSVMLSEADVIVGNYNHLFDPGSRP-LLS---DV
                                                                                

1981|gene|hwa       LNERTIAIIDEAHQLEERSRDNLSTSVDLYTLMKARNDVRIARQYASGSIVDSPTPNLPR
1431|hp|hla         ------------------------------------------------------------
960|gene|nph        IDEETFVICDEAHMLEPRVRDLVGDSVSDRALADAAGELSRVIETVAAVEEAGQSAEHGP
816|gene|hla        LDNSTFVVCDEAHMLEPRVRDLVSDAVADASLRDAENELTRVVQPL-SFETAGAESDD--
18810|gene|hbo      ADDSTFVVCDEAHMLEPRVRELVSDGVGDATLRDAENELTRVIQPV-EFDDSGKGTED--
1383|gene|nrc1      IDDSTFVVVDEAHRLEERVRDLLSDRLGRHTLTRARNDCRTLLTRA------NQSREN--
2465|gene|hut       LDERTFVIVDEAHRLEGRVRDLLSDRLGRQTIVQARNDCHQLRSMA------RQSPDH--
10680|gene|hma      LDNQTLVIVDEAHRLEERVRDLLSDRLGRQSIVQARNDCTTLIQRA------QQSADH--
1333|gene|hhi       LDDQTLVIVDEAHRLEERVRDLLSDRLGRQTIVQARNDCTTLIQRA------QQSADH--
                                                                                

1981|gene|hwa       E----DAELAQKIVEDGAKLRTSGIEVEELRAVEKLLNIAKQRLIDAS--ETIDAVGLIH
1431|hp|hla         ------------------------------------------------------------
960|gene|nph        EARARAETVRQELNGTDVTLGELRDTRRLLGALGDRLDERVTASLDRR-DPGWRQH----
816|gene|hla        -----AELVRGELEDADVSVDEIESVREFYADLRGELDRRVTERLDRE-RPDWRAS----
18810|gene|hbo      -----AELVRGELEDADVMLRELKETRDFVRDVREELDRRVTAYLDRT-MPDWRAD----
1383|gene|nrc1      -----RQQVTDHLASHDCSLDAVEAMVGFLDDVLEWLDDRVARYLAAE---GFDPDRPGS
2465|gene|hut       -----KREVRAHLGSQDVPLEAVDRARDFYDDLLDWLDDRIAAHLDDEVGRSWRAD-DAA
10680|gene|hma      -----KAQVREVLSAREVPLDAVDQARKFYDDLVRWLDNRIESFLDAE-HEGWRAD-PSS
1333|gene|hhi       -----KAQVREVLSAREVPLDAVDQARKFYDDLVRWLDDRVEAFLDAE-HEGWRAD-PST
                                                                                

1981|gene|hwa       RFGQEDSEAQSREIKSLVDPNNLNWGDQLTRDLERDESISMSVMQGAERIMSRLEKVFTA
1431|hp|hla         ------------------------------------------------------------
960|gene|nph        LPDLDDDELPLRDPETPETDELTRWAEENGFDERLWVRAEAVCAA-----------AATV
816|gene|hla        MRELDDDEVPLRDPEEPGEDEITAWAKREGYGDRVWARAEQVGAV-----------VKRV
18810|gene|hbo      LTRLEDDEIPLRDPEEPATDELTEWAESEGYDEGAWVRAETVGAV-----------AARI
1383|gene|nrc1      LPE-RDHEIPLRDPESEQPDALTQWAEQHGHTGDAWRSLAATGTA-----------VQAI
2465|gene|hut       LPE-HDLEIPLRDPDEPEPDELTRWAEQAGYDGDLFRQLDTIGLA-----------VEDA
10680|gene|hma      LPE-HDREIPLRDPDTVEQDELTEWAERKGYEGSLWRSLSKVGAA-----------VEDA
1333|gene|hhi       LPE-HDREIPLRDPDTVEQDELTEWAERKGYDGSLWRSLSQVGAA-----------VEDA
                                                                                

1981|gene|hwa       FTEHGILSRTPQGQEVGAFFQQWAQAPHAVYHPEVRVIPSQKESFPDQFPAWVEHWTPEL
1431|hp|hla         ------------------------------------------------------------
960|gene|nph        LNTLDEDDKRRAAPAVGRTLARWRRCDHTDYFRAIDLERTWDDTRPAE-S-WRRAYTASY
816|gene|hla        LDSLEEEDKQRAAPGVGRTLNAWYREGHDDFFRAIDLERTWDETAPPD-S-WRRAYNASL
18810|gene|hbo      LNSAEDEDKRRAAPAVGRMLANWARTDHTSFFREIELDRTWDETAREN-S-WRRAYNAHL
1383|gene|nrc1      LDDDG--DRSAVAGPVGVTLQRWWERDHATYFREVELEHVPKESGRAG-AAWAESYTPAL
2465|gene|hut       SEELGV-GRTPVVGAAGVIMRRWWEHDHATTFREIELDHSPRDDQRIE-G-WRATYTAGL
10680|gene|hma      IDQLGL-TRQPVCAAVGVLAGQWWERDHATFLREIELEHSPNHGQTLD-ADYQAVYTPGL
1333|gene|hhi       IDQLGL-TRQPVCAAVGVLAGQWWERDHATFLREIELEHSPNHGQSLD-ADYQAVYTPGL
                                                                                

1981|gene|hwa       RLFNCIPKRELRRVFSELGSGILMSATLRPKEPFRESIGIDAVPQLGELDTKVQSTEDEM
1431|hp|hla         ------------------------------------------------------------
960|gene|nph        TLHNCLPADEIGERLAAFGGGVLMSATLEPLDVFAEVTGLRHLER-----------EAD-
816|gene|hla        ALYNCLPSEPIGDRLAEFGGGVLMSATLEPMDVFREVTGLDHLEQ-----------RG--
18810|gene|hbo      ALHNCLPGDAIAEQLGEFGGGVLMSATLEPLDVFREVSGLNALEA-----------DG--
1383|gene|nrc1      VMFNCMPARALRETLSEVGGGVLMSATLEPLDVFREVAGLDRLAA------GAGDSDP--
2465|gene|hut       TLFDCLPAEALARTFEDVGGGVLMSATLEPLDVFTRVSGLDTLEEWDD---DRDEHDG--
10680|gene|hma      LCYNCMPATALRNVFDDLGGGILMSATLEPLDVFTRVSGLDSMAETGSTAPDEQSGDG--
1333|gene|hhi       LCYNCMPATALRNVFDDLGGGILMSATLEPLDVFTRVSGLDSMAETGSTAPDEDSGDG--
                                                                                

1981|gene|hwa       TLRMNGITDEMTEDVETRPTTFDRFPLRFSPENRLSVVVDLPKFTKANRGERETN---HQ
1431|hp|hla         -------------------------------------------------GNP--------
960|gene|nph        -----------------RPVVERTYGLEFPEANRASFAVDAPKFTYENRGDP------GD
816|gene|hla        -----------------RPVVERTYGLSFPPENRASFAVDAPKFTHQNRGAP------GE
18810|gene|hbo      -----------------RPVVERTYGLGFPEENRASFAVDVPKFTYENRGAP------GE
1383|gene|nrc1      -----------------RPVVERRYDLRFPESNRASFLVDATPFTAHNRGDPEP----GT
2465|gene|hut       -----------------RPVLTRSYGLSFPPANRASWIVDATPFTARNRGDPATMEPLGT
10680|gene|hma      -----------------RPVRSTTYDLPFPPENRASYLVDATPFTARNRGDPGTMRPLGD
1333|gene|hhi       -----------------RPVRTTTYDLPFPSENRASYLVDATPFTARNRGDPETMRPLGD
                                                                     *          

1981|gene|hwa       AMTDIREQYAEVIAQVARTEGNILIAMPSYSEAAWAHEYLRTLSIEKRCFVDKSSTADET
1431|hp|hla         ------------------------------------------------------------
960|gene|nph        E-TPTRQAHARAIRQVAAAPGNVLVCLPSYREAEWAASVLSA--LDKEVLVDEATDDVAT
816|gene|hla        E-NDTRLAHLDATVAVASREGNVLVGTPSYAEATWMAESLSKR-LDKPVLLDESSGDRAT
18810|gene|hbo      D-NETRRAYVDACAEISRSPGNVLVGMPSYAEAEWMAGELDTR-LSKTVLLDESSDDGAT
1383|gene|nrc1      D-NPTRDEYRYVLRTVARQPGNVLVCMPNYREAAWAAAYLSDGVVEKDVLVDESSSNAAT
2465|gene|hut       EWNPTRDEYAHVLRAIARNPGNVLIAMPNYREATWAGAYLDDA-VEKPVLVDESSSSEAT
10680|gene|hma      NWNPTRDEYAQALRALARSPGNVMVAMPNYREARWAGAYLQDA-VEKPVLVDESSSNEET
1333|gene|hhi       SWNPTRDEYAQALRALGRSPGNVMIAMPNYREARWAGAYLQAA-VEKSVLVDESSSNEET
                                                                                

1981|gene|hwa       DMLLSKFFESGDAILCTSLRGTITEGVDFDGEKLHTCLSVGVPLAPPSS-EMDAVEIAYQ
1431|hp|hla         ------------------------------------------------------------
960|gene|nph        ERLKQSFFEGEPKVLVTSLRGTLTEGVDYRGDRLSAAIVCGVPIINTASPQTRAVRTAYD
816|gene|hla        ESLKDDFFAGDGKVLVTSLRGTLTEGVDYRGDRLSAAVVCGVPIINTARPRTRAVITAYD
18810|gene|hbo      ERLKADFFGGEEKVLVTSLRGTLTEGVDYRGDRLSAAVVCGVPIINTSSPRTRAVKTAYD
1383|gene|nrc1      DDLKATFFAGDGKVLVTSTRGTLTEGVDYDGAKLGACLVVGVPLVNVGSPRIRAVRRAYA
2465|gene|hut       EDLKRDFFAGEGKVLVTSTRGTLTEGVDYDGAKLRAAAVVGVPLVNIGSPRVRAVQRAYG
10680|gene|hma      ERLKREFFSGDGKVMVTSTRGTLTEGVDYDGEKLSTCAVVGIPLVNIGSPRVRGVQRAYG
1333|gene|hhi       ERLKREFFSGDGKVMVTSTRGTLTEGVDYDGEKLSTCAVVGIPLVNIGSPRVRGVQRAYG
                                                                                

1981|gene|hwa       RAITE----------------TGGQEAARLIPSTRRVRQSVGRVIRGVNETGVRILADER
1431|hp|hla         ------------------------------------------------------------
960|gene|nph        RAFGD------------------GFKYALSVPAVRKARQAVGRVIRGPDECGVRVLCDER
816|gene|hla        RRFES------------------GFETALTVPAVRKARQAVGRVIRGTDEHGVRVLLDAR
18810|gene|hbo      REFGNVPASDSSGSPRGASASRDGFEAALTVPAVRKARQTIGRVIRGSEEVGIRALVDAR
1383|gene|nrc1      DAFGD----------------DHAFEYALTVPAVRRARQAIGRVIRGPEEVGVRVFAGGR
2465|gene|hut       DVFGE----------------DHAFEYALTIPAVRRARQAIGRVIRGAEEVGVRALVGAR
10680|gene|hma      DAFGE----------------DNAFEYALTVPAVRRARQAIGRVIRGVDEVGVRALVGRR
1333|gene|hhi       DAFGE----------------DNAFEYALTVPAVRRARQAIGRVIRGVDEVGVRALVGRR
                                                                                

1981|gene|hwa       YGTSDSTNLRRYLSPQQQREFTPVEYTDLGGAITRFWQYHK--
1431|hp|hla         -----------------------------------F-------
960|gene|nph        YARESWDSVRDLLGEAEREEFQPVGSDMLDFALEQFWDDAA--
816|gene|hla        YARESWNSVREYLPDHEREEYQPVSPDMLGLALDRFERQVGNE
18810|gene|hbo      YARDSWNSVREYLPESEREEFSPVSSDMLRFGVDRFWSSVD--
1383|gene|nrc1      YVEDARHSVFEYLGPGERAEFTTLTPSFLGSQLDAFRSESD--
2465|gene|hut       YTPEARHSVYGYLSPAEREEFVTMSSEFLPDQIDRFWAER---
10680|gene|hma      YTPDARHSVSPYLPAGEREEFTRMTPDFLASQLDSFWADHRAD
1333|gene|hhi       YTPDARHSVYQYLPAGEREEFTRMTPDFLASQLDSFWADHQ--
                                                       *