HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0081COG4347arCOG02940hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0081 nrc1 VNG1791 vng1791 no entry
cHOG0081 hmu HMUK1532 Hmuk_1532 protein of unknown function DUF1405
cHOG0081 hma RRNAC1731 hypothetical protein
cHOG0081 hwa HQ1711A hypothetical protein
cHOG0081 hwa HQ3324A hypothetical protein
cHOG0081 hla HLAC1366 Hlac_1366 protein of unknown function DUF1405
cHOG0081 hbo HBOR18070 Hbor_18070 predicted membrane protein, COG4347
cHOG0081 hbo HBOR07430 Hbor_07430 predicted membrane protein, COG4347
cHOG0081 hut HUTA0008 Huta_0008 protein of unknown function DUF1405
cHOG0081 hvo HVO_2335 HVO_2335 Protein of unknown function (DUF1405) superfamily
cHOG0081 nph NP4530A hypothetical protein
cHOG0081 hhi 2263 HAH_2263 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4530|hp|nph        ------------------------------------MNLRRYLESDVP-RDDLPWYLAPL
1366|gene|hla      ------------------------------------MNIVDALGRDPPDRESLPRWLAPL
3324|hp|hwa        MKLPMRNCVLVSPPMRCYQSCISAITHGVIYMSISDALHRLTSDQGLPSADRLPRWLSPV
7430|hp|hbo        ------------------------MATSTGIRRLVDEARRLADDDGLPPADQLPWWLAPL
1711|hp|hwa        -------------------------------------------MTSIPVADDLPVYLSPL
18070|hp|hbo       -------------------------------------------MASSPSTDDLPVYLAPL
1791|chp|nrc1      ---------------------------MRRPRDRRHVPMPTRDAAETTPDDTLPWYVAPL
8|hp|hut           ---------------------------MAGVGRRFERAVGTVFDAELPSSPGRPQYVAPL
11731|hp|hma       ------------------------MAPDEGVGGRIDAVVARVFSRRLPDAEGLPQYVAPL
2263|hp|hhi        ------------------------MATDEGVGARIDAAVARVFSRRLPDAEGLPRYVAPL
                                                                  .     * :::*:

4530|hp|nph        PAALENLALNLAWLVVAVNLAGTAFGFYYYSP------------QLAQTPVEMWVFVPDS
1366|gene|hla      PKALEDIAFRFVWVIVAINLLGTAFGFWYYRF------------QFRELPVEMWAFIPDS
3324|hp|hwa        PRWLENLGLRLVPAIIIINVLGTLFGFWYYGFHPIPQTDPLITWQFASEPVIMWPFVPDS
7430|hp|hbo        PEWLENVGLNLVWTVVAINLVGTVFGFWYYGFHPLPLSDPLIVWQFASEPVVMWPFVPDS
1711|hp|hwa        PAQIETFVFQYSWVVIMINIAGSIFGLWYYRF------------QLLNTPLAMWPVVPDS
18070|hp|hbo       PNWVESMTLRLTWVVVAVNLVGTVFGFWYYRF------------QLLNSHLVIWPAVPDS
1791|chp|nrc1      PTRLEDLALRLAWVIAAINVAGTVFGFWYYRI------------QLADTPLAAWIFVPDS
8|hp|hut           PTWLEDIALRLAWPIAIVNLVGTVFGFWYYAGRPLNVEAPLLEGQLGAAPLPAWPVVPDS
11731|hp|hma       PAWLENVGLRLAWPIALVNLVGTLFGFWYYAGRPLNTAPPLVEGQLGAAPLAAYPLIPDS
2263|hp|hhi        PAWLENVGLRLAWPIALVNLVGTLFGFWYYAGRPLNTAPPLVEGQLGAAPLAAYPLIPDS
                   *  :* . :.    :  :*: *: **::**              *:    :  :  :***

4530|hp|nph        PMATLFMALALASWKLGRPQQWLIALAFFGNIILGGWTVWVHLAFWEQF-SYLHPAMRQF
1366|gene|hla      PGATLLIALALAAWALGRSSDTLATLAFFGNVKLGLWTPYVLVVFYPAFLANSGPAMYAF
3324|hp|hwa        PLATLFIALAFFTWWRGKTNEYLAALAFFGCWKLGLWTPYVLTVFADAFLSVTWTPLYLF
7430|hp|hbo        PMATLFIAGAFALWRLDRTNEYVNALAFFGCWKLGLWTPFVLTAFSDAFLDQTALPMYLF
1711|hp|hwa        PFATMLMVGSLLSWRLGRNRNWIHALAFIGNLKYGFWVVAVQIFINDA--LVSQNPYYWF
18070|hp|hbo       PLATLLMAVSLVSWKLGQDRNWIHALAFVGNLKYGFWVVIVQIVINDV--LVSGDPYHWF
1791|chp|nrc1      PTATLFIAASLVAYKLDWDADWLHALAFFGCLKLGLWTPFVQLVVNGQ--GALWWGMYWF
8|hp|hut           PMATLLIALSLLAWRLDLQANWLHVLAFFGCLKLGLWTPFVQLFVNGPEGIATW--LYVF
11731|hp|hma       PVATMFIGLSLVAWRLDWDTQWLHMLGFFGCIKLGLWTPYVQLALNGPGGIPLW--LYWF
2263|hp|hhi        PVATMFIGLSLVAWRLDWDTQWLHMLGFFGCIKLGLWTPYVQLVLNGPGGIPLW--LYWF
                   * **:::  ::  :  .   : :  *.*.*    * *.  *   .              *

4530|hp|nph        LIWSHAAMVAQAFLLHRIGDFSPWAVGAATLWYGVDTTVDYFIPVRGDLHHTFL---PAD
1366|gene|hla      LLVSHLGMVVQAFVLHRITDFPLKAVGIATAWYTVDLLMDYFVPVIGEVTHTSI---PY-
3324|hp|hwa        LFISHLGMVIEAFVLHRIADFPIRAVGVALIWYGFNDIVDYLIPIVGDPHHTAI---PV-
7430|hp|hbo        LFFSHLAMVVEAFVLHRISDFPVRAVAVAIVWYGFNDVVDYFIPIVGDPHHTSI---PL-
1711|hp|hwa        LLISHFGMGLQAFVIYRYAEFSVPAVGIATSWFGFNDLVDYFTPIIGDYHHTYF--GPR-
18070|hp|hbo       LLVSHFGMGLQALVIYRYAEFTVPSVAVATLWFSFNDMVDYFLPLVGDYHHTYF--GPR-
1791|chp|nrc1      LVLSHFGMAVEAFIVHRYATFSVPAVGVALAWYGINDLLDYFLGVLGGPHHTLLRAE---
8|hp|hut           LITSHLAMVLEAFVIHRYAEFTLSAIGVATVWYGFNDLVDYFWPVLDGPHHTVLRAEPY-
11731|hp|hma       LILSHLAMAAEAFLIHRYASFSVMSVAVAVFWYGFNDVVDYFVPILDGPHHTWLRAEPIV
2263|hp|hhi        LILSHLAMAAEAFLIHRYASFSVVSVAVAVFWYGFNDIVDYFVPVLDGPHHTWLRAEPLA
                   *. ** .*  :*::::*   *.  ::. *  *: .:  :**:  : .   ** :      

4530|hp|nph        REAAMFLGADALGVAAAGAVLLFVVSVYLALTTHVATLRQRSTAA---
1366|gene|hla      LDTEPWFTTTVLQVAAAGAVALTVIPLFWALATRVATLQIRLDRGDGA
3324|hp|hwa        ADTTTVGNSTALHLAAAGAITLTFIATFFALSTRIYKIKARS------
7430|hp|hbo        ADGVIVGGSSVLQIAAAGAIVLTLVATFFSLTTRVKKLESGSIPRQTE
1711|hp|hwa        LASTGDHTIPAHDVAATAAVCLTLLAMFLAFAIRARRLSPAVAGNGG-
18070|hp|hbo       LVSAGDHGTRAHDVAAASAIGLTILATFLALAIRVRRLENRT------
1791|chp|nrc1      LGAEAPHALYAHDIAAACAVALTMLATYLALATHIHATEHRR------
8|hp|hut           VDGAYDHAVLAHDLAAAAAVVLTISAIVLALGTYRSQA----------
11731|hp|hma       AAGGFDHTVLAHDLAAGWAVVLTLIATFLALATRVEKVKRQA------
2263|hp|hhi        AAGGFDHTVLAHDLAAGWAVVLTLMATFLALATRVEKVKRQA------
                             .  :**  *: * . .   ::