HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0080COG1745arCOG02254Predicted metal-binding proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0080 nrc1 VNG1263 vng1263 no entry
cHOG0080 hmu HMUK2409 Hmuk_2409 conserved hypothetical protein
cHOG0080 hma RRNAC1164 hypothetical protein
cHOG0080 hma RRNAC1242 hypothetical protein
cHOG0080 hwa HQ2574A hypothetical protein
cHOG0080 hla HLAC1515 Hlac_1515 Protein of unknown function UPF0058
cHOG0080 hbo HBOR15350 Hbor_15350 predicted metal-binding protein
cHOG0080 hut HUTA0460 Huta_0460 conserved hypothetical protein
cHOG0080 hut HUTA0821 Huta_0821 conserved hypothetical protein
cHOG0080 hvo HVO_1679 HVO_1679 Predicted metal-binding protein conserved in archaea
cHOG0080 nph NP4316A hypothetical protein
cHOG0080 hhi 1836 HAH_1836 hypothetical protein
cHOG0080 hhi 1767 HAH_1767 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


460|chp|hut        MRKQELVHLHGLLAEVRRYCEQEDSRSLDLSKYESLGTDEAAIHRGKEQHRSAVFALAEA
1515|gene|hla      MKKQELIHLHGLLAEVRKQCEFW-DENIDLDAYEELGVKPTSIHKSKTDHKAAVFKLTEG
2574|hp|hwa        MKKQELIHLHGLLAEVHTQVEAWEETDIPLTAYNELGVRPTSIHKSKTDHKAAVFKLIEG
15350|hp|hbo       MKKQELIHLHGLLAEVHTQIEEWENDEVPLTAYNELGVRPTSIHKSKTDHKAAVFKLVKG
11242|hp|hma       MKKQELIHLHSLLAQVQHHYEHEADTSVEHDLYADLGVKPTSIHKSKTDHKEGVFALASG
1836|hp|hhi        MKKQELIHLHSLLAQVQHHYEHEADTSVEHDLYADLGVKPTSIHKSKTDHKEAVFALASG
1263|chp|nrc1      MKKQELIHLHGLLAEVSNYYEENAAEDVDLTDYNDLGVRPTSIHKSKTDHKAAVFALAGG
11164|hp|hma       MKKQELIHLHGLLAQVQNHYEAESGTEVDHDEYEELGVKPTSIHKSKTDHKAAVFAIADG
1767|hp|hhi        MKKQELIHLHGLLAQVQNHYEAESGTEVDHDEYEELGVKPTSIHKSKTDHKAAVFAIADG
4316|hp|nph        MKKQELIHLHGLLAEVCNHYEQIAECNVEHAKYTELGVRPTSIHKSKTDHKAAVFALADG
821|chp|hut        MKKQELIHLHGLLAQVRDHYEQTLDTEVEHQRYTELGVKPTSIHKSKTDHKAAVFALAEG
                   *.****:***.***:*    *     .:    * .**.  ::**..* :*. .** :  .

460|chp|hut        LTEGSE-EKQT---VVTTTD
1515|gene|hla      ITEPMD-ESES-EPLAPTAD
2574|hp|hwa        ITAPMD-ESEP-DRVAPTAD
15350|hp|hbo       ITSSLD-EPEQ-EAVAPHAD
11242|hp|hma       LTDAMA-EEAD-EPQALTAD
1836|hp|hhi        LTDAMA-EEAD-EPQALTAD
1263|chp|nrc1      ITSTMATEDDETEAVPASAD
11164|hp|hma       IASEMA-DETK-EPVSAAAD
1767|hp|hhi        IASEMA-DETK-EPVSAAAD
4316|hp|nph        ITEEME-SETE-TAVSAAAD
821|chp|hut        ITGELE-STTDTERVSAAAD
                   ::     .          :*