HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0079COG0050KOG0460arCOG01561GTPases - translation elongation factorstranslation elongation factor eEF-1A subunit alpha

HOG Organism Gene ID Name Annotation
cHOG0079 nrc1 VNG2649 eef1a translation elongation factor eEF-1A subunit alpha
cHOG0079 hmu HMUK0497 Hmuk_0497 translation elongation factor EF-1, subunit alpha( EC:3.6.5.3 )
cHOG0079 hma RRNAC2406 eef1a elongation factor 1-alpha
cHOG0079 hwa HQ3385A tef1a elongation factor 1-alpha
cHOG0079 hla HLAC0156 Hlac_156 translation elongation factor EF-1, subunit alpha
cHOG0079 hbo HBOR28110 Hbor_28110 translation elongation factor 1A (EF-1A/EF-Tu)( EC:3.6.5.3 )
cHOG0079 hbo HBOR08460 Hbor_08460 translation elongation factor 1A (EF-1A/EF-Tu)( EC:3.6.5.3 )
cHOG0079 hut HUTA0811 Huta_0811 translation elongation factor EF-1, subunit alpha
cHOG0079 hvo HVO_0359 HVO_0359 tuf translation elongation factor EF-1 subunit alpha
cHOG0079 nph NP0304A tef1a elongation factor 1-alpha
cHOG0079 hhi 2841 tef1A translation elongation factor EF-1 subunit alpha
MUSCLE (3.6) multiple sequence alignment


8460|gene|hbo       -MSEKPHQNLAIIGHVDHGKSTLVGRLLFETGSIPEHIIEQHREEAEEKGKSGFEFAYVM
2649|gene|nrc1      -MSDNRHQNLAVIGHVDHGKSTMVGRLLYETGSVPEHVIEQHKEEAEEKGKGGFEFAYVM
811|gene|hut        MSEDTAHQNLAIIGHVDHGKSTLVGRLLFETGSVPEHVIEQHREEAEEKGKGGFEFAYVM
3385|gene|hwa       -MSDKPHQNLAIIGHVDHGKSTLVGRLLFETGSVPEHVIEQHREEAEEKGKGGFEFAYVM
156|gene|hla        -MSDKPHQNLAIIGHVDHGKSTLVGRLLFETGSVPEHVIEQHREEAEEKGKGGFEFAYVM
28110|gene|hbo      -MSDKPHQNLAIIGHVDHGKSTLVGRLLFETGSVPEHVIEQHREEAEEKGKGGFEFAYVM
12406|gene|hma      -MSDEQHQNLAIIGHVDHGKSTLVGRLLYETGSVPEHVIEQHKEEAEEKGKGGFEFAYVM
2841|gene|hhi       -MSDEQHQNLAIIGHVDHGKSTLVGRLLYETGSVPEHVIEQHKEEAEEKGKGGFEFAYVM
304|gene|nph        MSEDKPHQNLAVIGHVDHGKSTMVGRLLFETGSVPEHVIEQYREEAEEKGKGGFEFAYVM
                      .:  *****:**********:*****:****:***:***:.********.********

8460|gene|hbo       DNLAEERERGVTIDIAHQRFDTDKYYFTIVDTPGHRDFVKNMITGASQADHAVLVVAADD
2649|gene|nrc1      DNLAEERERGVTIDIAHQEFTTDEYEFTIVDCPGHRDFVKNMITGASQADNAVLVVAADD
811|gene|hut        DNLAEERERGVTIDIAHQEFDTEEYNFTIVDCPGHRDFVKNMITGASQADNAVLVVAADD
3385|gene|hwa       DNLAEERERGVTIDIAHQEFDTEDYYFTIVDCPGHRDFVKNMITGASQADNAVLVVAADD
156|gene|hla        DNLAEERERGVTIDIAHQEFDTDNYYFTIVDCPGHRDFVKNMITGASQADNAVLVVAADD
28110|gene|hbo      DNLAEERERGVTIDIAHQEFDTDEFYFTIVDCPGHRDFVKNMITGASQADNAVLVVAADD
12406|gene|hma      DNLAEERERGVTIDIAHQEFSTDTYDFTIVDCPGHRDFVKNMITGASQADNAVLVVAADD
2841|gene|hhi       DNLAEERERGVTIDIAHQEFSTDAYDFTIVDCPGHRDFVKNMITGASQADNAVLVVAADD
304|gene|nph        DNLAEERERGVTIDIAHQEFDTDEYYFTIVDCPGHRDFVKNMITGASQADNAVLVVAADD
                    ****************** * *: : ***** ******************:*********

8460|gene|hbo       GVAPQTREHVFLARTLGIEELIIAVNKMDIVDYSEDTYKQVKAEVQELLKQVQFNTADAS
2649|gene|nrc1      GVAPQTREHVFLSRTLGIDELIVAVNKMDVVDYDESKYNEVVSGVKDLFGQVGFNPDDAK
811|gene|hut        GVQPQTQEHVFLARTLGIDELIVAVNKMDLVDYEESRYKETVQEVTELLKQVQFNTDDAS
3385|gene|hwa       GVAPQTREHVFLARTLGINELIIGVNKMDIVDYSEETYEDVKTEVDKLLKQVQFNANDAK
156|gene|hla        GVAPQTREHVFLARTLGINEIIIGVNKMDLVDYKESSYDQVVEEVNDLLNQVRFATDDTT
28110|gene|hbo      GVAPQTREHVFLARTLGIGELIIAINKMDVVDYSEDTYKQVTEEVQNLLKQVRFQSDNAT
12406|gene|hma      GVQPQTQEHVFLARTLGIGELIVAVNKMDLVDYGESEYKQVVEEVKDLLTQVRFDSENAK
2841|gene|hhi       GVQPQTQEHVFLARTLGIGELVVGVNKMDLVDYGESEYKQVVEEVKDLLTQVRFDPDNAK
304|gene|nph        GVQPQTQEHVFLARTLGIDELIIAVNKMDLVDYDENKYKAVVDEVNQLLEQVRFNTEDAK
                    ** ***.*****:***** *:::.:****:*** *. *. .   * .*: ** * . ::.

8460|gene|hbo       FIPISAFEGDNVAESSENMDWFDGPTILESLNSLPEPSPPTDAPLRLPIQDVYTISGIGT
2649|gene|nrc1      FIATSAFEGDNVSDHSDNTPWYDGPTLLEALNGLPVPQPPTDADLRLPIQDVYTISGIGT
811|gene|hut        FIPSSAFEGDNINELSDNMPWYDGPTVLESLNNLPEPEPPTDAPLRLPIQDVYTISGIGT
3385|gene|hwa       YIPISAFEGDNVAESSDNTSWFDGPSLLEALNNLPEPQPPTDAPLRLPIQDVYTISGIGT
156|gene|hla        FVPISAFEGDNISEESENTPWYDGPTLLESLNDLPESEPPTDAPLRLPIQDVYTISGIGT
28110|gene|hbo      FVPISAFEGDNIADASDNTSWYDGKTLLEALNDLPAPEPPTDAPLRLPIQDVYTISGIGT
12406|gene|hma      FIPVSAFEGDNIAEESEHTGWYDGEILLEALNELPAPEPPTDAPLRLPIQDVYTISGIGT
2841|gene|hhi       FIPLSAFEGDNVAEESENTDWYDGEILLEALNNLPAPEPPTDAPLRLPIQDVYTISGIGT
304|gene|nph        FIPTSAFEGDNVSEASENTSWYDGPSLLEALNDLPEPQPPTDAPLRLPIQDVYTISGIGT
                    ::. *******: : *::  *:**  :**:** ** ..***** ****************

8460|gene|hbo       VPVGRVETGILNTGDNVSFQPSDVSGEVKTIEMHHEEVPKAEPGDNVGFNVRGIGKDDIR
2649|gene|nrc1      VPVGRIETGVMNTGDNVSFQPSDVGGEVKTIEMHHEEVPNAEPGDNVGFNVRGIGKDDIR
811|gene|hut        VPVGRIETGEMFPGDDVTFQPSDVGGEVKTVEMHHEEVDRAGPGDNVGFNVRGVGKDDIR
3385|gene|hwa       VPVGRVETGTVSPGDDVSFQPSDVGGEVKTVEMHHEEVDQAGPGDNVGFNVRGIGKDDIR
156|gene|hla        VPVGRVETGILNIGDNVSFQPSDVGGEVKTVEMHHEEVPKAEPGDNVGFNVRGLGKDDIR
28110|gene|hbo      VPVGRIETGTLNPGDNVSFQPSDVGGEVKTVEMHHEEVDQAGPGDNVGFNVRGVGKDDIR
12406|gene|hma      VPVGRVETGILNTGDNVSFQPSDVSGEVKTVEMHHEEVPKAEPGDNVGFNVRGVGKDDIR
2841|gene|hhi       VPVGRVETGILNTGDNVSFQPSDVSGEVKTVEMHHEEVPKAEPGDNVGFNVRGVGKDDIR
304|gene|nph        VPVGRVETGILNTGDNVSFQPSDVSGEVKTVEMHHEEVPKAEPGDNVGFNVRGVGKDDIR
                    *****:*** :  **:*:******.*****:******* .* ***********:******

8460|gene|hbo       RGDVCGPADEPPSVAETFQAQIVVMQHPSVITAGYTPVIHAHTAQVACTFESIDKKIDPS
2649|gene|nrc1      RGDVCGPADDPPSVADTFQAQVVVMQHPSVITAGYTPVFHAHTAQVACTIESIDKKMDPA
811|gene|hut        RGDVCGPADDPPSVAETFQAQIVVMQHPSVITAGYTPVFHAHTAQVACTVESIDQKIDPS
3385|gene|hwa       RGDVCGPSSNAPTVAETFKAQVVVMQHPSVITAGYTPVFHAHTAQVACTIESIDQKLDPA
156|gene|hla        RGDVCGPADDPPSVAETFKAQVVVMQHPSVITAGYTPVFHAHTAQVACTIEEINQKIDPA
28110|gene|hbo      RGDVCGPADEPPSVAETFKAQVVVMQHPSVITAGYTPVFHAHTAQVACTIEAIDQKLDPA
12406|gene|hma      RGDVCGPADDPPSVAETFQAQIVVMQHPSVITEGYTPVFHAHTAQVACTVESIDKKIDPS
2841|gene|hhi       RGDVCGPADDPPSVAETFQAQIVVMQHPSVITEGYTPVFHAHTAQVACTVESIDKKIDPS
304|gene|nph        RGDVCGPADDPPSVAETFQAQVVVMQHPSVITAGYTPVFHAHTAQVACTIESIDKKIDPS
                    *******:.:.*:**:**:**:********** *****:**********.* *::*:**:

8460|gene|hbo       SGEVAEEEPDFIKAGDAAVVTLRPQKPLVLEPSSEIPELGSFAIRDMGQTIAAGKVLEVN
2649|gene|nrc1      SGETQEENPDFIQSGDAAVVTVRPQKPLSLEPSSEIPELGSFAVRDMGQTIAAGKVLDVD
811|gene|hut        SGEVAEENPDFIQSGDAAVVTIRPQKPLSIEPSGEIPELGSFAIRDMGQTIAAGKVLSVD
3385|gene|hwa       SGEVAEEDPDFIKSGDAAVVTVRPQKPLSIEPSNEIPELGSFAVRDMGQTIAAGKVLEVD
156|gene|hla        SGEVAEENPDFIKSGDAAVVTVRPQKPLSIEPSGEIPELGSFAIRDMGQTIAAGKVLEVN
28110|gene|hbo      SGEVAEENPDFIKSGDAAVVTVRPQKPLSIEPSGDIPELGSFAVRDMGQTIAAGKVLEVN
12406|gene|hma      SGEVAEENPDFIQNGDAAVVTVRPQKPLSIEPSSEIPELGSFAIRDMGQTIAAGKVLGVN
2841|gene|hhi       SGEVAEENPDFIQNGDAAVVTVRPQKPLSIEPSSEIPELGSFAIRDMGQTIAAGKVLSVN
304|gene|nph        SGEVAEENPDFIQSGDAAVVTVRPQKPLSIESSNEIPELGSFAIRDMGQTVAAGKVLSVN
                    ***. **:****: *******:****** :*.*.:********:******:****** *:

8460|gene|hbo       KR-
2649|gene|nrc1      EA-
811|gene|hut        ERE
3385|gene|hwa       ER-
156|gene|hla        ER-
28110|gene|hbo      ER-
12406|gene|hma      ER-
2841|gene|hhi       ER-
304|gene|nph        ER-
                    :