HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0780arCOG04616hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0780 nrc1 VNG0508 vng508 no entry
tucHOG0780 hmu HMUK2811 Hmuk_2811 conserved hypothetical protein
tucHOG0780 hma RRNAC0928 hypothetical protein
tucHOG0780 hwa HQ2626A hypothetical protein
tucHOG0780 hla HLAC1786 Hlac_1786 hypothetical protein
tucHOG0780 hbo HBOR16100 Hbor_16100 hypothetical protein
tucHOG0780 hut HUTA1485 Huta_1485 conserved hypothetical protein
tucHOG0780 hvo HVO_1611 HVO_1611 conserved hypothetical protein
tucHOG0780 nph NP1672A hypothetical protein
tucHOG0780 hhi 1561 HAH_1561 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1786|hp|hla       MSTDLTFTDDGVDVVYEGTEFELEKDLIEEATGKGYRDVTDHEVLQIVAKEPALDGEPVR
508|hp|nrc1       -MTSLSVADDGVDVVYEGTEFRLEKPLIEDATQSDYHDVTDHDLLKLVEPNPTLSGEPRR
1485|chp|hut      -MTALSFDEDGVDVVYEGTDFRLDKQMIEDAVGKSYPDVTDHEVLQLVDPEPSLSGEPQR
10928|hp|hma      -MTVLSFDEQGVDVVYEGTEFRLEKALIEDAIQKSYPNVTDHEVLQMVEPEPALSGEPQR
1561|hp|hhi       -MTVLSFDEQGVDVVYEGTEFRLEKALIEDAIQKSYPDVTDHEVLQMVEPEPALSGEPQR
2626|hp|hwa       -MTVLSFDDDGVDVIYDGTEFRLEKTLIEEAIEKPYPDVTDHEVLKIIEQDPTLGDEPRR
16100|hp|hbo      -MTVLSFDEKGVDVEYQGTEFRLEKALIEDATEKSYPDVTDHEVLKIVEEDPSLSGEPRR
1672|hp|nph       -MTVLSFDEEGVDVIYEGTEFRLEKDLIEEATEKPYPEVTDHEVLQIIEENPSLSDEPRR
                    * *:. :.**** *:**:* *:* :**:*  . * :****::*:::  :*:*..** *

1786|hp|hla       IGDVL--
508|hp|nrc1       IGDILD-
1485|chp|hut      IAEIIP-
10928|hp|hma      IAEIVN-
1561|hp|hhi       IAEIVN-
2626|hp|hwa       VADILR-
16100|hp|hbo      IKDILNT
1672|hp|nph       IADILG-
                  : :::