HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0779COG1758KOG3405arCOG01268DNA-directed RNA polymerase subunit K/omegaDNA-directed RNA polymerase subunit K

HOG Organism Gene ID Name Annotation
cHOG0779 nrc1 VNG1141 rpoK DNA-directed RNA polymerase subunit K
cHOG0779 hmu HMUK2597 Hmuk_2597 RNA polymerase Rpb6( EC:2.7.7.6 )
cHOG0779 hma RRNAC0068 rpoK DNA-directed RNA polymerase subunit K
cHOG0779 hwa HQ2936A rpoK DNA-directed RNA polymerase subunit K
cHOG0779 hla HLAC1824 Hlac_1824 RNA polymerase Rpb6
cHOG0779 hbo HBOR12480 Hbor_12480 DNA-directed RNA polymerase, subunit K( EC:2.7.7.6 )
cHOG0779 hut HUTA2516 Huta_2516 RNA polymerase Rpb6
cHOG0779 hvo HVO_2775 HVO_2775 RNA polymerases K / 14 to 18 kDa subunit
cHOG0779 nph NP2844A rpoK DNA-directed RNA polymerase subunit K
cHOG0779 hhi 827 rpoK DNA-directed RNA polymerase subunit K
MUSCLE (3.6) multiple sequence alignment


1141|gene|nrc1      -----MSDSQHFSRYEKARIIGARALQVAYGAPVLVDTDQTEPILIAAEEYDADALPFTV
10068|gene|hma      -------MNAQESRYEKARKLGARALQLAHGAPVLIETEHTQPILIAAEEYDAGVLPFTV
827|gene|hhi        -------MNAQESRYEKARKLGARALQLAHGAPVLIETEHTQPILIAAEEYDAGVLPFTV
2936|gene|hwa       MSHSQTHTQPTYNRYEKARILGARALQISYGAPVLVDTEQSEPILVAAEEYDAGVLPFTV
2844|gene|nph       --------MRGTNRYEKARILGARALQVSYGAPVLIETDQTEPILVAAEEYDADALPFTV
2516|gene|hut       ------MPNEQYNRYEKARILGARALQVAYGAPVLIDTDQTQPILIAAEEYDAGVLPFTV
1824|gene|hla       ------MSEQRYNRYEKARILGARALQVSYGAPVLIDTDQTEPILVAAEEYDAGALPFTV
12480|gene|hbo      -------MQQRYNRYEKARILGARALQVSYGAPVLLDTDQSEPILIAAEEYDAGVLPFTV
                                .****** :******:::*****::*::::***:*******..*****

1141|gene|nrc1      RREGT
10068|gene|hma      NRSD-
827|gene|hhi        NRSD-
2936|gene|hwa       KQEDS
2844|gene|nph       HRGEK
2516|gene|hut       NRGN-
1824|gene|hla       RRESN
12480|gene|hbo      QREGK
                    ..