HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0778COG1860arCOG04477Uncharacterized protein conserved in archaeahypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0778 nrc1 VNG1401 vng1401 no entry
cHOG0778 hmu HMUK2227 Hmuk_2227 Protein of unknown function UPF0179
cHOG0778 hma RRNAC1064 transcription regulator
cHOG0778 hwa HQ3004A hypothetical protein
cHOG0778 hla HLAC2319 Hlac_2319 Protein of unknown function UPF0179
cHOG0778 hbo HBOR13620 Hbor_13620 uncharacterized conserved protein
cHOG0778 hut HUTA0414 Huta_0414 Protein of unknown function UPF0179
cHOG0778 hvo HVO_2851 HVO_2851 conserved protein
cHOG0778 nph NP3406A hypothetical protein
MUSCLE (3.6) multiple sequence alignment


10640|gene|hma      MISLEMDMVQYDCPYIDTTRDYEVSFLAKQWDFHPVERELETRIMVNGADREELDRGLNA
414|hp|hut          ------------------------------------------------------------
3406|hp|nph         ------------------------------------------------------------
1401|chp|nrc1       ------------------------------------------------------------
3004|hp|hwa         ------------------------------------------------------------
2319|gene|hla       ------------------------------------------------------------
2851|hp|hvo         ------------------------------------------------------------
13620|hp|hbo        ------------------------------------------------------------
                                                                                

10640|gene|hma      LETHDHMESYQLLRRKGDLALIRSRIDETNAMSVIRDHSGYITG-PFRIRDGSEIWHVGF
414|hp|hut          ---------------MTQITLLGTRLAEPGTEFVYQGESPACDGCPYRDQCLNLDVGRRY
3406|hp|nph         ---------------MSTVTLLGERLAEVGTEFVYGGETDACEGCPYREQCLNLTEGRRY
1401|chp|nrc1       ----------------MPITLLGPRLADPGTEFVYHGPADDCEGCPYRQQCLNLTEGVRY
3004|hp|hwa         ---------------MSHVTLIGDRLASTGTEFVYEGESVACEGCPYRKQCLNLTEGVRY
2319|gene|hla       ---------------MTTVTLIGTRLADTGREFVYQGESPDCEGCPYRSQCLNLSEGTRY
2851|hp|hvo         ---------------MTSVTLVGARLTDPGTEFVYHGESSACEGCPYRRQCLNLIEGVRY
13620|hp|hbo        ---------------MTKVTLIGDRLAEPGTQFVYRGPSSACEGCPYRKQCLNLEVGVRY
                                      ::*:  *: . .   *  . :    * *:* .  .      :

10640|gene|hma      DTERVAEG--TLSELERDNDYTIRSRESVDLEDYYDLLQNIDSAKRLVDGCRELSEVERN
414|hp|hut          HVTSIRDGASTLDCAVHDEGVTAIEVEPAPIQANVTSQSAYAGSKVELEGTCPHEECPSH
3406|hp|nph         RVTGVRDSG-TLECAVHDTGVTAVEVEPAPVLANVDANAAYAGSKASLVGPCPYTECPSH
1401|chp|nrc1       EVTDVREGGQVLDCAVHDEGAVAVDVEPTTIPATVPSKGAYAGSKGKLAGPCPHTECPSH
3004|hp|hwa         EITDVRDDGQLLDCAVHDTGVRAVEVEPTSVVANVATREAYAGGKAELPGSCPHTECPSH
2319|gene|hla       RVTGIRENAQTLDCAVHDAGVRAVEVEPAPVPANVLSKQAYAGGRVSLAGPCPHTECPSH
2851|hp|hvo         RVLDVRENTQVLDCAVHDEGVRAVEVEPAPVTANVPSKGAYAGSKASLQGPCPHTECPSH
13620|hp|hbo        EVTGIRENAQLLDCAVHDTGVRAVEVEPAPVVANVPSKGAYAGSKASLAGPCPHTQCPSH
                        : :.   *.   .* .    . *.. :           ...  : *     :   :

10640|gene|hma      TLEKAVEGGYFDTPRDATLSSLAEEFDVSKMAISKNLRRSQRKILDRVTTAMNDVTE
414|hp|hut          GLCEP-AGADFETPYR--IDSVIGDPPHEYCMLDRDLTKVELAPPESE---------
3406|hp|nph         EFCEP-DGADFDEEYQ--ITEVVGDPPHDYCMLDRELQLVQFAAEE-----------
1401|chp|nrc1       EFCEP-AGASFDTEYQ--IAEIDGEPPHDHCALDRDLTLVEFAPAER----------
3004|hp|hwa         EYCVP-DGAEFDTEYQ--IETVHGDPPHEHCQLDRELTLVEFKPPDTTSN-------
2319|gene|hla       GYCVP-DGADFDDERV--IDQVLGEPPHDVCALDRDLTLVEFRAEDG----------
2851|hp|hvo         EYCVP-EGAEFDQEYR--IHDVLGDPPHDHCHLDRNLTLVEFEPADE----------
13620|hp|hbo        EYCVP-EGADFDEEYR--IAEVRGDPPHDFCYLDRDLTLVEFAAESD----------
                        .  *. *:      :  :  :   .   :..:*   :    .