HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0777COG0839arCOG04654NADH:ubiquinone oxidoreductase subunit 6 (chain J)hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0777 nrc1 VNG0641 vng641 no entry
cHOG0777 hmu HMUK1922 Hmuk_1922 NADH dehydrogenase subunit J( EC:1.6.5.3 )
cHOG0777 hma RRNAC1452 ndhG6 NADH dehydrogenase subunit J
cHOG0777 hwa HQ1643A nuoJ NADH dehydrogenase subunit J
cHOG0777 hla HLAC0709 Hlac_709 NADH dehydrogenase subunit J
cHOG0777 hbo HBOR21420 Hbor_21420 NADH dehydrogenase subunit J( EC:1.6.5.3 )
cHOG0777 hut HUTA0697 Huta_0697 NADH dehydrogenase subunit J
cHOG0777 hvo HVO_0983 HVO_0983 ndhG NAD(P)H-quinone oxidoreductase chain 6
cHOG0777 nph NP2304A nuoJ1 NADH dehydrogenase subunit J
cHOG0777 hhi 2033 nuoJ1 NADH dehydrogenase subunit J (ubiquinone)
MUSCLE (3.6) multiple sequence alignment


11452|gene|hma      --MALAESIAFALFAIVTVGSAAGVVLVRDVWHSALLLGVSLISVAVFYVMNQAAFVATM
2033|gene|hhi       --MALAESIAFALFAMVTVGSAAGVVLVRDVWHSALLLGVSLVSVAVFYVMNQAAFVATM
697|gene|hut        --MGVLELIAFGLFALTTVGASLGVVLVRDVWHAALMLGIALLSVAVFYVMNQAPFVAAM
2304|gene|nph       MAVVPLETLAFLLFALLTVGASLGVVLARDVWHSALFLGAALFSVAVHYVMLRAEFLAVI
641|chp|nrc1        ---MPYETLAFALFAALTVASSLGVVLVRDVWHSALLLGIALLSIGVHYVMLQAPFLMAM
709|gene|hla        ---MVYATIAFGLFAAVTLAFGLGVVLARDVFHAALLLGGALTSVAVHYVMLQAEFIAAM
1643|gene|hwa       ---MVYETIAFVLFALVTVGCSLGVVLMQDVWHSALLLGGALLSVAVHYVMLQAEFLAVM
21420|gene|hbo      ---MVYETIAFALFALITVGCSLGVVLVRDIWHSALLLGGALLSVAVHYVMLQAEFLAAM
                            :** ***  *:. . **** .*::*:**:** :* *:.*.*** .* *: .:

11452|gene|hma      QILVYVGGVLILITFAVMLTREDESVIEVTP-
2033|gene|hhi       QILVYVGGVLVLITFAVMLTREDESVIEVTP-
697|gene|hut        QVLVYVGGVLILISFAVMLTRRNDPDSDGVAQ
2304|gene|nph       QVLVYVGGVLILITFAVMLVRQDNTGGEALT-
641|chp|nrc1        QILVYVGGVLILITFAVMLTK--KQPGVTSS-
709|gene|hla        QILVYVGGVLILVTFAVMLTRSDTETEVNSA-
1643|gene|hwa       QILVYVGGVLILVTFAVMLTR--TQPEGSNI-
21420|gene|hbo      QILVYVGGVLILVTFAVMLTR--TRLEASST-
                    *:********:*::*****..