HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0775COG0838arCOG01557NADH:ubiquinone oxidoreductase subunit 3 (chain A)NADH dehydrogenase/oxidoreductase-like protein

HOG Organism Gene ID Name Annotation
cHOG0775 nrc1 VNG0635 nolB NADH dehydrogenase/oxidoreductase-like protein
cHOG0775 hmu HMUK1917 Hmuk_1917 NADH-ubiquinone/plastoquinone oxidoreductase chain 3( EC:1.6.5.3 )
cHOG0775 hma RRNAC1447 nolB NAD(P)H-quinone oxidoreductase chain 3
cHOG0775 hwa HQ1637A nuoA NADH dehydrogenase, subunit A (ubiquinone)
cHOG0775 hla HLAC0704 Hlac_704 NADH-ubiquinone/plastoquinone oxidoreductase chain 3
cHOG0775 hbo HBOR21470 Hbor_21470 NADH:ubiquinone oxidoreductase subunit 3 (chain A)( EC:1.6.5.3 )
cHOG0775 hut HUTA0706 Huta_0706 NADH-ubiquinone/plastoquinone oxidoreductase chain 3
cHOG0775 hvo HVO_0978 HVO_0978 nolB NAD(P)H-quinone oxidoreductase chain 3
cHOG0775 nph NP2292A nuoA NADH dehydrogenase-like complex, subunit A
cHOG0775 hhi 2028 nuoA NADH dehydrogenase subunit A (ubiquinone)
MUSCLE (3.6) multiple sequence alignment


11447|gene|hma      MQVTFHPRACRFLKTRKAEKPNNEPLYASTSNRETIGDTGMSNPWIAIGALAVVALAIPL
2028|gene|hhi       ----------------------------------------MSNPWIAIGALAVVALAIPL
706|gene|hut        ----------------------------------------MSNPWIAIGALAVVGLVIPL
2292|gene|nph       ----------------------------------------MSDPWIAVGALAVVGLAIPL
635|gene|nrc1       -----------------------------------------MNPWIAIGMLALVSVLIPA
704|gene|hla        -----------------------------------------MSDWIAIGALAVVGLVIPL
1637|gene|hwa       -----------------------------------------MSEWIAVGALGLVAVGIPL
21470|gene|hbo      -----------------------------------------MSEWIAIGALALVAVGIPL
                                                              . ***:* *.:*.: ** 

11447|gene|hma      TMMAVSSLLRPSVPEQGKRTTYESGEVPTGSSRQIKFNIQYYMVALLFVVFDIETVFIFP
2028|gene|hhi       TMMAVSSLLRPSVPEQGKRTTYESGEVPTGSSRQIKFNIQYYMVALLFVVFDIETVFIFP
706|gene|hut        SMIAISALIRPSVPEQSKRATYESGEVPTGGTR-IQFNIQYYMVALLFVVFDIETVLIFP
2292|gene|nph       SMIVISSLLRPSVPEQGKSATYESGEIPTGDTR-IQFNIQYYMVALLFLVFDVETALIFP
635|gene|nrc1       GMLSVSSLIRPSVSEQGKRATYESAEVPTGNAR-LQFNTQYYMVALLFLVFDIETVLIFP
704|gene|hla        AMMSVSALLRPSVPETGKSTTYESGETPTGGTR-IRFNIQYYMVALLFVVFDIETVLLFP
1637|gene|hwa       GMMAISAILRPTVPEQGKSATYESGEIPTGSAR-VQFNIQYYMIALLFLVFDVETVLILP
21470|gene|hbo      GMMAVSAILRPSVPEQGKSATYESGEIPTGTAR-VQFNIQYYMVALLFVVFDIETVLIFP
                     *: :*:::**:*.* .* :****.* *** :* :.** ****:****:***:**.:::*

11447|gene|hma      WTVIYSDAAA--ELGMTTALLPMVVFITILAIGLGWAWRNGAVQWVRSPRATKGADTYE-
2028|gene|hhi       WTVIYSDAAA--ELGMTTALLPMVVFITILAIGLGWAWRNGAVQWVRSPRATKGADTYE-
706|gene|hut        WTVIYGDAVE--AVGLWRALAPMVGFIAILAVGLGWAWRNGAVRWVTSKRASRQRVES--
2292|gene|nph       WALIYSDAVA--EFGLVRVLVPMLVFLAILIIGLGWAWRNGAVRWVRSERAEIKTEL---
635|gene|nrc1       WTVIYRDALAMDGIGLTNVLAPMLVFIGILVVGLAWAWRKGVVQWMRTP-AHEQRTTHE-
704|gene|hla        WAVIYRPAIS-AGVPMIDLLWPMLAFVGVLAVGLVWAWRSGAISWARSPRATSRKTERDL
1637|gene|hwa       WTVIYRPALE-AGADLTTVLLPMLVFIGILIVGLVWAWRNGAVKWIKSPLANRQKTERDI
21470|gene|hbo      WTVIYRSALS-QGADLATVLLPMLIFIGVLVVGLAWAWRNGAVEWVKSPLAKRRKTERQD
                    *::**  *       :   * **: *: :* :** ****.*.: *  :  *         

11447|gene|hma      -
2028|gene|hhi       -
706|gene|hut        -
2292|gene|nph       -
635|gene|nrc1       -
704|gene|hla        N
1637|gene|hwa       -
21470|gene|hbo      A