HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0771COG0048KOG1750 KOG1749arCOG04255Ribosomal protein S1230S ribosomal protein S12P

HOG Organism Gene ID Name Annotation
cHOG0771 nrc1 VNG2658 rps12p 30S ribosomal protein S12P
cHOG0771 hmu HMUK0510 Hmuk_0510 ribosomal protein S23 (S12)
cHOG0771 hma RRNAC2424 rps12P 30S ribosomal protein S12P
cHOG0771 hwa HQ3391A rps12P 30S ribosomal protein S12P
cHOG0771 hla HLAC0101 Hlac_101 ribosomal protein S23 (S12)
cHOG0771 hbo HBOR28170 Hbor_28170 SSU ribosomal protein S12P
cHOG0771 hut HUTA2383 Huta_2383 ribosomal protein S23 (S12)
cHOG0771 hvo HVO_0353 HVO_0353 ribosomal protein S23 (S12)
cHOG0771 nph NP0122A rps12P 30S ribosomal protein S12P
cHOG0771 hhi 2855 rps12P 30S ribosomal protein S12P
MUSCLE (3.6) multiple sequence alignment


122|gene|nph        MANGKYAARKLKQDRQKHRWSDSDYARRARGLGKKSDPLEGAPQGRGIVLEKVGIEAKQP
12424|gene|hma      MANGKYAARKLKKDRQKHRWSDTDYARRERGLGKKSDPLEGAPQGRGIVLEKVGIEAKQP
2855|gene|hhi       MANGKYAARKLKKDRQKHRWSDTDYARRERGLGKKSDPLEGAPQGRGIVLEKVGIEAKQP
101|gene|hla        MANGKYAARKLKQDRQKRRWSDSEYARRERGLKKKSDPLEGAPQARGIVLEKVGIEAKQP
28170|gene|hbo      MANGKYAARKLKKDRQQRRWSDSEYARRERGLRKKSDPLEGAPQARGIVLEKVGIEAKQP
2383|gene|hut       MANGKYAARKLKKDRQQHRWSDSKYARRERGLGAKSDPLEGAPQGRGIVLEKVGIEAKQP
3391|gene|hwa       MANGKYAARKLKQDRQQRRWSDSEYARRERGLGAKSDPLEGAPQGRGIVLEKVGIEAKQP
2658|gene|nrc1      MTNGKYAARKLKKDRQQRRWSDSEYARRERGLGKKSDPLEGAPQGRGIVLEKVGIEAKQP
                    *:**********:***:.****:.**** ***  **********.***************

122|gene|nph        NSAIRKCVRVQLIKNGKQVTAFCPGDGAISFIDEHDEVTIAGIGGAKGRAMGDLSGVNYK
12424|gene|hma      NSAIRKCVRVQLIKNGKQVTAFCPGDGAISFIDEHDEVTIAGIGGAKGRAMGDLSGVNYK
2855|gene|hhi       NSAIRKCVRVQLIKNGKQVTAFCPGDGAISFIDEHDEVTIAGIGGAKGRAMGDLSGVNYK
101|gene|hla        NSAIRKCVRVQLIKNGKQVTAFCPGDGAISFIDEHDEVTIAGIGGAKGRAMGDLSGVNYK
28170|gene|hbo      NSAIRKCVRVQLIKNGKQVTAFCPGDGAISFIDEHDEVTIAGIGGAKGRAMGDLSGVNYK
2383|gene|hut       NSAIRKCVRVQLIKNGKQVTAFCPGDGAISFIDEHDEVTIAGIGGAKGRAMGDLSGVNYK
3391|gene|hwa       NSAIRKCVRVQLIKNGKQVTAFCPGDGAISFIDEHDEVTIAGIGGAKGRAMGDLSGVNYK
2658|gene|nrc1      NSAIRKCVRVQLIKNGKQVTAFCPGDGAISFIDEHDEVTIAGIGGAKGRAMGDLSGVNYK
                    ************************************************************

122|gene|nph        VEKVNGVSLIELVRGNAEKPVR
12424|gene|hma      VEKVNGVSLIELVRGNAEKPVR
2855|gene|hhi       VEKVNGVSLIELVRGNAEKPVR
101|gene|hla        VEKVNGVSMIELVRGNAEKPVR
28170|gene|hbo      VEKVNGVSMIELVRGNAEKPVR
2383|gene|hut       VEKVNGVSMIELVRGNAEKPVR
3391|gene|hwa       VEKVNGVSLIELVRGNAEKPVR
2658|gene|nrc1      VEKVNGVSLIELVRGNAEKPVR
                    ********:*************