HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0770COG1383KOG0187arCOG01885Ribosomal protein S17E30S ribosomal protein S17E

HOG Organism Gene ID Name Annotation
cHOG0770 nrc1 VNG1433 rps17e 30S ribosomal protein S17E
cHOG0770 hmu HMUK2585 Hmuk_2585 30S ribosomal protein S17e
cHOG0770 hma RRNAC0055 rps17E 30S ribosomal protein S17e
cHOG0770 hwa HQ3016A rps17E 30S ribosomal protein S17e
cHOG0770 hla HLAC2338 Hlac_2338 30S ribosomal protein S17e
cHOG0770 hbo HBOR11080 Hbor_11080 SSU ribosomal protein S17E
cHOG0770 hut HUTA0766 Huta_0766 30S ribosomal protein S17e
cHOG0770 hvo HVO_2475 HVO_2475 30S ribosomal protein S17e.-related protein
cHOG0770 nph NP1992A rps17E 30S ribosomal protein S17e
cHOG0770 hhi 814 rps17E 30S ribosomal protein S17e
cHOG0770 hhi 5322 rps17E 30S ribosomal protein S17e
MUSCLE (3.6) multiple sequence alignment


5322|gene|hhi       MQADPQEIIDIGDRLLSEYPELFT-EQYETNTRLVQRLASVDSFRTQTRLTRYITRQKRT
1433|gene|nrc1      MAIKPDYVKKTGNILMERYQDAFSREDFEHNKDAVTELTNIESKNVRNRIAGYITHKRN-
1992|gene|nph       MAIKPAYVKKTGTLLMDRYPKAFG-DDFEHNKELVDELTNIESKSVRNRIAGYVTRKQRS
10055|gene|hma      MAIKPAYVKKTGTLLMERYPDAFG-ADFEHNKDVVEELTNIESKGVRNRIAGYVTRKMNN
814|gene|hhi        MAIKPAYVKKTGTLLMERYPDAFG-ADFEHNKDVVEELTNIESKGVRNRIAGYVTRKMNN
766|gene|hut        MAIKPAYVKKTGTILLERYPRAFS-ADFEHNKDVVEELTNIESKGVRNRIAGYVTHKQGS
2338|gene|hla       MAIKPKYIKQLGNVLLERYPDSFN-TDFETNKDSVTTLTTVESKGVRNRIAGYVTQKKAQ
3016|gene|hwa       MAIKPKYVKQLGTLLLEEYPQAFN-TDFETNKESVETLTNVESKGVRNRIAGYITRKKGS
11080|gene|hbo      MAIKPKYVKQLGKVLLDKYPQAFN-TDFETNKESVSKLTNVESKGVRNRIAGYITRKKGG
                    *  .*  : . *  *:. *   *   ::* *.  *  *:.::*  ...*:: *:*.:   

5322|gene|hhi       RNGSER--
1433|gene|nrc1      --------
1992|gene|nph       PQQPA---
10055|gene|hma      PVEA----
814|gene|hhi        PVEA----
766|gene|hut        AVEA----
2338|gene|hla       AAQKA---
3016|gene|hwa       NTPPSASA
11080|gene|hbo      SSQTA---