HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0769COG2098arCOG04705Uncharacterized protein conserved in archaeahypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0769 nrc1 VNG0127 vng127 no entry
cHOG0769 hmu HMUK0577 Hmuk_0577 Protein of unknown function DUF381
cHOG0769 hma RRNAC2306 hypothetical protein
cHOG0769 hwa HQ1136A hypothetical protein
cHOG0769 hla HLAC0062 Hlac_62 Protein of unknown function DUF372
cHOG0769 hbo HBOR27270 Hbor_27270 uncharacterized conserved protein
cHOG0769 hut HUTA1827 Huta_1827 conserved hypothetical protein
cHOG0769 hvo HVO_0510 HVO_0510 conserved protein
cHOG0769 nph NP0408A hypothetical protein
cHOG0769 hhi 2760 HAH_2760 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1827|chp|hut      ---MEPTDAHRATFELGIKFGALYHQFAGTPISPASAAELASAIESAIENQPHCEEVSVG
1136|hp|hwa       MQTTAATTAEEACFEAGIKFGTLYHQFAGTPVSPASASTLEDAIADAIENQPHCEAVSVT
62|gene|hla       ----MTTDAQQACFEAGIKFGSLYHQFAGTPVSPASARSLEAAMAEAIENQPFCESVTVE
127|chp|nrc1      ----MATDAQQACFEAGIKFGALYHQFAGTPVSPASAPSLETAIEESIRNQPFCEGVAVD
408|hp|nph        ---MKPTTPQEACFEAGIKFGTLYHQFAGTPVAPESSDSLAAAMEDAIENQPFCTAVTVD
12306|hp|hma      ---MEPTAPQEACFEAGVKFGSLYHQFAGTPISPDSADSLAAAMEEAIENQPFCEAVTVS
2760|hp|hhi       ---MEPTAPQEACFEAGVKFGSLYHQFAGTPISPASADSLAAAMEEAIENQPFCEAVTVS
27270|hp|hbo      ----MPTDAQNACFEAGIKFGSLYHQFAGTPVSPESADSLARAIEESIANQPYCEAVRVT
                       .* .  * ** *:***:*********::* *:  *  *: .:* ***.*  * * 

1827|chp|hut      MKTEAIETAV-DPDVGYTEFTGEFADVEILVDYEGLEARGVMEMDDGYPRMRLVGIDDTA
1136|hp|hwa       VRTDRLETALAEQSAEYTELTGKFFDVTMQIEYNGCRVQTQMTMDGDYPLMEIVAVESPT
62|gene|hla       IHDDRVADAI-DHENGYTELTGSLMDVEMQIAYEGIEVRTRMAMRDGYPLMELVSVEAAK
127|chp|nrc1      IKTERL-----DVEHGYTELTGEYMDVELRIDYEGTTVAAEMAMDDGYPLMRLAEIDP--
408|hp|nph        ILDEKLRKTLAEQSADYTELTGEYMEVELIIEYDGCTVAASMAMDGDYPRMQVDDVDG--
12306|hp|hma      VRMEALESAIAEGGADYTELTGRFIDVEMQIEYEGVTVETSMAMEDGYPLMQVDAVQE--
2760|hp|hhi       VRTEALEDAIAEGGADYTELTGRFIDVEMRIEYEGVTVETSMAMEDGYPLMQVDAVQE--
27270|hp|hbo      IRRDELEAALEDATADYTELTGRFLDVEMDIEYEGTAVQTKMEMEDGYPLMKLVSVEE--
                  :  : :     :    ***:**   :* : : *:*  .   * * ..** * :  ::   

1827|chp|hut      ----
1136|hp|hwa       DDSS
62|gene|hla       SD--
127|chp|nrc1      ----
408|hp|nph        ----
12306|hp|hma      ----
2760|hp|hhi       ----
27270|hp|hbo      ----