HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0768COG2150arCOG02316Predicted regulator of amino acid metabolism contains ACT domainregulator of animo acid metabolism

HOG Organism Gene ID Name Annotation
cHOG0768 nrc1 VNG2296 aamR regulator of animo acid metabolism
cHOG0768 hmu HMUK0864 Hmuk_0864 amino acid-binding ACT domain protein
cHOG0768 hma RRNAC2554 hypothetical protein
cHOG0768 hwa HQ1027A hypothetical protein
cHOG0768 hla HLAC2625 Hlac_2625 amino acid-binding ACT domain protein
cHOG0768 hbo HBOR02610 Hbor_02610 predicted regulator of amino acid metabolism, contains ACT domain
cHOG0768 hut HUTA2125 Huta_2125 amino acid-binding ACT domain protein
cHOG0768 hvo HVO_2984 HVO_2984 conserved protein
cHOG0768 nph NP1404A hypothetical protein
cHOG0768 hhi 2982 HAH_2982 amino acid-binding ACT domain-containing protein
MUSCLE (3.6) multiple sequence alignment


2296|chp|nrc1      ------------MQKFEGSPGQQAVIRLLLERGFSVNDGGRVVSGGIEIPYTQVAQEAGV
2625|gene|hla      -------MFDEILEKFEGSPSQQAVIRLFLERGFSVNEEGRVVSGGIEIPYTGIARELDV
2125|gene|hut      MTADQSASFEAIMEKFEDSPSQQRVIRLLLERGFSVNDDGRVVSGGIEIPNTGIAREVDV
12554|hp|hma       -------MFDEIMQKFEDSPGQQDVIRLLLERGFSVNEDGRVVSGGIEIPNTGIAREANV
2982|gene|hhi      -------MFDEIMQKFEDSPGQQDVIRLLLERGFSVNEDGRVVSGGIEIPNTGIAREAGV
1404|hp|nph        -------MFDEIMRKFEDSPSQQAVIRLLLERGFSVNDDGRVVSGGIEIPNTGIAREIDV
1027|hp|hwa        -------MFDEIMQKFEESPSQQAVIRLLLQRGFSVNDEGRVVSGGIEIPNTGIAREIDV
2610|hp|hbo        -------MFDEIMRKFEGSPSQQEVIRLLLERGFSVNDEGRVVSGGIEIPNTGIAREIDV
                               : *** **.** ****:*:******: *********** * :*.* .*

2296|chp|nrc1      DRRVVDSTTEAILDDGELTRIFQNISQIPSLMDLAPVLDLHVVTVAVQDADEPGIVAAVT
2625|gene|hla      DRRVVDSTTDAILADPELKRIFTNISSVPSLMDLAPVLDLTVLTIEVAAAGEAGIVAEVT
2125|gene|hut      DRRVVDATTDAILEDPQLRRIFQNISAIPSLMDLAPVLDLAVMTVAVREAEESGIVATVT
12554|hp|hma       DRRVVNATTDAILDDDDLRRIFRNISSVPSLLDLAPVLDLHAVTVTVRAADESGIVSTVT
2982|gene|hhi      DRRVVNATTDAILDDDDLRRIFRNISSVPSLLDLAPVLDLHAVTVTVRAADESGIVSTVT
1404|hp|nph        DRRVVDATTDAILDDDELRRIFQNISAIPSLMDLAPVLDLTVLTVRVGDADQPGIVAAVT
1027|hp|hwa        DRRVVDSTTTAILDDDELRRIFQNISSIPSLMDLAPVLNLSALIVEVNNADQPGLVAAIA
2610|hp|hbo        DRRVVDSTTSAILEDEELRRIFQNISSIPSLMDLAPVLDLSVLTVEVADADAPGIVAEIT
                   *****::** *** * :* *** *** :***:******:* .: : *  *  .*:*: ::

2296|chp|nrc1      GLLADHGIPIRQTISEDPEFTDEPRLYVVTDEELPGAVFTALAEMSAVRSVELS
2625|gene|hla      GILADHGISIRQVLSEDPEFTDDPKLYVITDTDLSGDLLVEIRDLEYVRRVGF-
2125|gene|hut      ELLADRDISIRQVITEDPEFTDQPRLYVITDDAVPGDLLNEIRELAFVHKIELQ
12554|hp|hma       SAIADHGISIRQVLSEDPEFTDEPKLYVITDEELPGDLINEIRRLAFVRTIELA
2982|gene|hhi      SAIADHGISIRQVLSEDPEFTDEPKLYVITDEELPGDLINEIRRLAFVRTIELA
1404|hp|nph        SLLADNGVSIRQTISEDPEFTDEPKLYIVTDEQLDGELINEVRALPFVRKIELE
1027|hp|hwa        TRLADRNISIRQTISEDPEFTDDPKLYIVTDDPIPGELVNELTELSFVYRISLA
2610|hp|hbo        GRLAERDISIRQTISEDPEFTDDPKLYLVTDQPVPGDLLNELSSISFVRQISIA
                     :*:..:.***.::*******:*.**::**  : * :.  :  :  *  : :