HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0767COG0231KOG3271arCOG04277Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A)translation initiation factor eIF-5A

HOG Organism Gene ID Name Annotation
cHOG0767 nrc1 VNG1768 eif5a translation initiation factor eIF-5A
cHOG0767 hmu HMUK1604 Hmuk_1604 translation initiation factor eIF-5A
cHOG0767 hma RRNAC1929 eif5A translation initiation factor IF-5A
cHOG0767 hwa HQ3348A tif5A translation initiation factor IF-5A
cHOG0767 hla HLAC1578 Hlac_1578 translation initiation factor eIF-5A
cHOG0767 hbo HBOR07140 Hbor_07140 translation initiation factor 5A (eIF-5A)
cHOG0767 hut HUTA2581 Huta_2581 translation initiation factor eIF-5A
cHOG0767 hvo HVO_2300 HVO_2300 eif5A translation initiation factor eIF-5A
cHOG0767 nph NP4752A tif5A translation initiation factor IF-5A
cHOG0767 hhi 2438 eif5A translation initiation factor IF-5A
MUSCLE (3.6) multiple sequence alignment


1768|gene|nrc1      MAKEQKEVRDLQEGNYVMMEDAACQINAYSTAKPGKHGSAKARIEAEGVFDGKKRSLSQP
4752|gene|nph       MPKEQKEVRDLQEGNYVMIEDVPSKITSYSTSKPGKHGSAKARVEGTGVFDGQKRNFTQP
11929|gene|hma      MAREQTEVRELDEGSYVMIEDTPCKINSYSTAKPGKHGSAKARIDAKGVFDGKKRSLSQP
2438|gene|hhi       MAREQTEVRELDEGSYVMIEDTPCKINSYSTAKPGKHGSAKARIDAKGVFDGKKRSLSQP
2581|gene|hut       MAKQQTEVRELDEGSYVMMDDEPCKITAYSTAKPGKHGSAKARIDGKGVFDGKKRSLSQP
1578|gene|hla       MPREQKQVRELQEGSYVMMDSSPCKINHYSTAKPGKHGSAKARVEGKGVFDEKKRSLSQP
3348|gene|hwa       MPREQKQVRELQEGSYVMMDESPCEINSYSTAKPGKHGSAKARVEGNGVFDDRKRSLSQP
7140|gene|hbo       MPKEQKQVRELQEGSYVMMDESPCKINAYSTAKPGKHGSAKARIEGKGVFDSKKRSLSQP
                    *..:*.:**:*:**.***::. ..:*. ***:***********::. **** .**.::**

1768|gene|nrc1      VDAKIWVPIVNRKQGQIVSKESDTVAQVMDLETYETVTMQIPGELDIQADENIEYLEFEG
4752|gene|nph       VDAKVWVPIVNRKQGQVVSVSGDD-MQVMDLETYETITMRIPEDLAPESDDEIEYLEFEG
11929|gene|hma      VDAKVWVPIVNRKQGQVVSTDGND-AQVMDLDTYDTFTMRVPEDIDLQPDDEIEYLQYEE
2438|gene|hhi       VDAKVWVPIVNRKQGQVVSTDGND-AQVMDLDTYDTFTMRVPEDIDLQPDDEIEYLQYEE
2581|gene|hut       VDAKIWVPIIERKQGQVVSVSGND-AQVMDLETYETFTMRVPEDESLSPDDEIEYLELEE
1578|gene|hla       VDAKVWVPIIQRKQGQVVSVSGDD-AQVMDLDTYETFTMRIPEGEDFTSDDNIEYLEYEG
3348|gene|hwa       VDAKVWVPIIERKQGQVVSVTGSD-AQIMDLDNYQTFTMRVPEDQDMSPDDEIEYLEYEG
7140|gene|hbo       VDAKVWVPIIERKQGQVVSVTGSD-AQIMDLSTYETFTMRIPEDEDLSPEDEIEYLEYEG
                    ****:****::*****:**  ..   *:***..*:*.**.:*      .:::****: * 

1768|gene|nrc1      QRKILQE
4752|gene|nph       QRKVV--
11929|gene|hma      QRKITRS
2438|gene|hhi       QRKITRS
2581|gene|hut       QRKIV--
1578|gene|hla       QRKVVG-
3348|gene|hwa       QRKIV--
7140|gene|hbo       QRKIV--
                    ***: