HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0764COG0361KOG3403arCOG01179Translation initiation factor 1 (IF-1)translation initiation factor eIF-1A

HOG Organism Gene ID Name Annotation
cHOG0764 nrc1 VNG2234 eif1a1 translation initiation factor eIF-1A
cHOG0764 hmu HMUK0702 Hmuk_0702 translation initiation factor eIF-1A
cHOG0764 hma RRNAC2474 eif1A1 translation initiation factor IF-1A
cHOG0764 hwa HQ3399A tif1A1 translation initiation factor IF-1A
cHOG0764 hla HLAC2368 Hlac_2368 translation initiation factor eIF-1A
cHOG0764 hbo HBOR00870 Hbor_00870 translation initiation factor 1A (aeIF-1A)
cHOG0764 hut HUTA1606 Huta_1606 translation initiation factor eIF-1A
cHOG0764 hvo HVO_0136 HVO_0136 eif1A translation initiation factor eIF-1A
cHOG0764 nph NP1258A tif1A_1 translation initiation factor IF-1A
cHOG0764 hhi 2905 eif1A2 translation initiation factor IF-1A
MUSCLE (3.6) multiple sequence alignment


2368|gene|hla       ---------------------MSNGDGGGRNDLRMPDEDEVFAEVVEMLGANRVRVRCAD
2234|gene|nrc1      ---------------------MSDDG-GGRKNLRMPEDDEVFAEVTDMLGANRVQVRCAD
3399|gene|hwa       ---------------------MSDDENRGSHDLRMPDDDEVFAVVTNMLGANRVTVRCAD
870|gene|hbo        ---------------------MSDNENAGRRDLRMPDDDEEFAVVQDMLGANRVKVRCAD
1258|gene|nph       ---------------------MSDNE--GRKNLRMPEGDEVFAVVTNMLGANRVKVRCMD
1606|gene|hut       ---------------------MSDQE---RTDLRMPDEDEVFAVVTNMLGANRVKVRCMD
12474|gene|hma      MDRVHGPTFPNLKPLPVEVPSMSDND--SRKNLRMPEEDEVFAVVMDMLGANRVKVRCMD
2905|gene|hhi       ---------------------MSDND--SRKNLRMPEEDEVFAVVMDMLGANRVKVRCMD
                                         **:       :****: ** ** * :******* *** *

2368|gene|hla       GKERTARIPGRMQKRVWIREDDIVLVEPWDWQDEKGDIAWRYEKSEAEQLREEGHLQ---
2234|gene|nrc1      GEERTARIPGRMQKRIWIREDDIVLVEPWDWQDDKADVTWRYEKSDADQLREEGHIE---
3399|gene|hwa       GNERTARIPGRMQKRIWIREDDVVLVEPWDWQDEKGDITWRYEKSEADQLREEGRIR---
870|gene|hbo        GVERTARIPGRMQKRIWIREGDVVLVEPWDWQDEKADVTWRYEKSEADQLREEGHIA---
1258|gene|nph       GTERTARIPGRMQKRIWIREDDVVLVEPWDWQDEKADVVWRYEKQEADQLREEGHITDSV
1606|gene|hut       GVERTARIPGKMQKRIWIREDDVVLIEPWDWQDEKADITWRYEKQQADQLREEGHIKEP-
12474|gene|hma      GVERTARIPGKMQKRIWIREDDVVLVEPWDWQDEKADITWRYEKQDADQLREEGHIQE--
2905|gene|hhi       GVERTARIPGKMQKRIWIREDDVVLVEPWDWQDEKADITWRYEKQDADQLREEGHIQE--
                    * ********.****:****.*:**:*******:*.*:.*****.:*:******.: