HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0762COG0295KOG0833arCOG04173Cytidine deaminasecytidine aminohydrolase

HOG Organism Gene ID Name Annotation
cHOG0762 nrc1 VNG0896 cda cytidine aminohydrolase
cHOG0762 hmu HMUK2739 Hmuk_2739 cytidine deaminase( EC:3.5.4.5 )
cHOG0762 hma RRNAC0446 cdd cytidine deaminase
cHOG0762 hwa HQ2646A cdd cytidine deaminase
cHOG0762 hla HLAC0939 Hlac_939 cytidine deaminase
cHOG0762 hbo HBOR16430 Hbor_16430 cytidine deaminase( EC:3.5.4.5 )
cHOG0762 hut HUTA1386 Huta_1386 cytidine deaminase
cHOG0762 hvo HVO_1581 HVO_1581 cdd cytidine deaminase
cHOG0762 nph NP3512A cdd cytidine deaminase
cHOG0762 hhi 1187 cdd cytidine deaminase
MUSCLE (3.6) multiple sequence alignment


1386|gene|hut       --MDERALLDAATDALEDAYVPYSEYPVGAALETTAGEVYRGFNVEVVNYSNSLHAEEVA
2646|gene|hwa       MMSSDHTLIARARTAFESAYVPYSEYRVGAAIETTDGSVYTGCNIENANYSNSLHAEEVA
3512|gene|nph       --MDDADLIDAARKAVEQSYAPYSEYYVGAAIATADGAVFSGCNIENANYSNSVHAEELA
10446|gene|hma      ----MEDLLDAARDAIDEAYAPYSEYTVGAALETSDGSVYTGCNIENANYSNSLHAEEVA
1187|gene|hhi       ----MEDLLDAARDAIDEAYAPYSEYTVGAALETSDGSVYTGCNIENANYSNSLHAEEVA
896|gene|nrc1       --MDTDDLLAAARDATAAAHVPYSEYKVGAALDTASGAVYTGCNIENANYSNSLHAEEVA
939|gene|hla        -----MDLIEAARDALDDAHVPYSEYRVGAALRTADGTVYTGCNIENANYSNSLHAEEVA
16430|gene|hbo      ---MPESLVTRAREMLEQAHVPYSEYRVGAALRTADGEVFVGCNIENANYSNSLHAEEVA
                           *:  *      ::.***** ****: *: * *: * *:* .*****:****:*

1386|gene|hut       LTGALRAGESDFERVAVVSAEHDGLTPCGMCRQTLAEFCADSFEILTEDDGEIT---HYT
2646|gene|hwa       VAAAVKDGQDTFERIAVASAARDGVTPCGMCRQTLAEFADGSLKVLCDKGAEGVE--TYT
3512|gene|nph       LSKAVEAGHRSFDRIAVSSARRDGVTPCGMCRQSLAEFCGDDLRIICDGPDGRV---EYT
10446|gene|hma      IGAAVSDGHRSFERVAVTSGKRDGVTPCGMCRQTFSEFCDESFEIITD-GDEPT---VYE
1187|gene|hhi       IGAAVSDGHRSFERVAVTSGKRDGVTPCGMCRQTFSEFCDESFEIITD-GDEPT---VYE
896|gene|nrc1       VGKAVSAGDTDFQRLAVTSSQRDAVTPCGMCRQTLAEFAADDLTILCDSGDDTAGVVTYT
939|gene|hla        LAEAVKNGHREFDRIAVTSGVRDGVTPCGMCRQSLTEFAADDLIVVCDEGDGETS--EYT
16430|gene|hbo      VAEAIKNGHREFDRLAVTSGARDGVTPCGMCRQTLAEFCDEDLVVVCDEGGEETT--EYT
                    :  *:  *   *:*:** *. .*.:********:::**.  .: :: :     .    * 

1386|gene|hut       LGDLLPAAMKPGNLQDRS----
2646|gene|hwa       LTELLPKTISEETLQNADGQ--
3512|gene|nph       LGELLPETITASHLQ-------
10446|gene|hma      LGELLPTTITSDHLDK------
1187|gene|hhi       LGELLPTTITSDHLDK------
896|gene|nrc1       LGELLPDTITASNLDA------
939|gene|hla        LGELLPNTISEDTLDDAREV--
16430|gene|hbo      LGELLPNTISLDTLEAAEAERE
                    * :*** ::.   *: