HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0076COG0517KOG1764arCOG00601FOG: CBS domainsimilar to F420--quinone oxidoreductase

HOG Organism Gene ID Name Annotation
cHOG0076 nrc1 VNG1663 quo similar to F420--quinone oxidoreductase
cHOG0076 hmu HMUK1776 Hmuk_1776 CBS domain containing membrane protein
cHOG0076 hma RRNAC1525 hypothetical protein
cHOG0076 hwa HQ3172A cbs CBS domain-containing protein
cHOG0076 hla HLAC1626 Hlac_1626 HAD-superfamily hydrolase, subfamily IA, variant 1
cHOG0076 hla HLAC3545b Hlac_3545 CBS domain containing protein
cHOG0076 hbo HBOR08170 Hbor_08170 predicted transcriptional regulator, contains C- terminal CBS domains
cHOG0076 hbo HBOR30750b Hbor_30750 predicted transcriptional regulator, contains C- terminal CBS domains
cHOG0076 hut HUTA2607 Huta_2607 CBS domain containing membrane protein
cHOG0076 hvo HVO_2384 HVO_2384 CBS domain pair putative
cHOG0076 nph NP2894A cbs_3 CBS domain-containing protein
cHOG0076 nph NP4504A cbs_1 CBS domain-containing protein
cHOG0076 hhi 2097 HAH_2097 CBS domain-containing membrane protein
MUSCLE (3.6) multiple sequence alignment


1626|gene|hla      ----------------------------------MYDAVVLDKDGVLVGRTPFDTLREAA
3172|gene|hwa      ----MDITNIATPDYVEVRADKRLGKIRSIFDRERPNGIIVTKEGGYNGVVGEKQLVRSR
8170|hp|hbo        ----MNIADIATPDFVEVDADKRLGKVRSIFERENSRGVIVTNDGEYAGVIGEKQLVRSR
4504|gene|nph      ----MNIADIATKDYAQVDADERLGKVRSVFEQDNPKGIVVTNDGDYEGIITERQLLQSH
1663|chp|nrc1      ----MDISDIAANDYVEVDAEQRLGKVRSLFERENPKGVIVTEAGAYDGVITERQLIQSH
2607|gene|hut      MTGTMDIADIATRDYIEVDADERLGKVRSIFERENPKGIIVTEGGEYAGVITQKELVQSH
11525|hp|hma       ----MDIADIATREFVEVDANKRLGKVRSIFERENPKGIIVTEDDDYTGVITQKQLVQSH
2097|gene|hhi      ----MDIADIATREFVEVDANKRLGKVRSIFERENPKGIIVTEDGDYAGVITQKQLVQSH
3545|gene|hla      ----MNISEILSPKFTEFDIGTPLSKVAGAFENQELDAVVVTDGDEYRGVVSRRQLASSS
30750|hp|hbo       ----MEILDIVSEEYEAVSPETRVSKLVGVFDDPTVKGVLV-QDTQFEGVVTRRQLATSR
2894|gene|nph      ----MDISAIVSTEFEELSPDTPVSKLTGVFDDPDVKGVVVSDDGDLVGVVTRRQLTTSH
                                                        .::: .     *      *  : 

1626|gene|hla      WDAFVSLGI----EDPDLAHVDD--------IAIGVDPATLTDICERYG-------LDPV
3172|gene|hwa      MGDDTKVDVVTK-SAPKLDRHEDIREAARMLVEGDVNVAPVFEGNQLYGIVTGEDILQAV
8170|hp|hbo        MEDDTKASAVMK-SAPKIDRHEDVREAARMLVEGDTRIAPAYEGEKLYGIITGNDILEAV
4504|gene|nph      VEDDAKANVLTRSNVPQVNREDGVREVARMLVEGDTKVAPVFEHGDLWGVITDNAILNAV
1663|chp|nrc1      IGDDTRVAAMVT-DAPKVSRTEDVRETARMLVEGGTKIAPVFEAGSLWGVITEDAILDAV
2607|gene|hut      VEDQAKARALMQ-HAPKIKRTGDVRETARVLVESGTKVAPVFEANKLWGVITDDDILSAV
11525|hp|hma       VEDNAKAGAMTR-SAPKVERTDDVREVARVLVEGGVKLAPVFEAGELWGIVTEDDILDAV
2097|gene|hhi      VEDNAKAGAMTR-SAPKVERTDDVREVARVLVEGGVKLAPVFEADELWGIVTEDDILDAV
3545|gene|hla      NQPSAKVGSRVQ-HVPTVNRTADVREVARLMIGSGAKTLPVLDDDRVVGIVTGDSILEAV
30750|hp|hbo       HPPDQKVGSLVW-HVPRLAPDEDVRKVARLMIDSDSQLLPVFEGDDVVGVVSADDILEAV
2894|gene|nph      HSPEEKLASLVW-HAPTVAPDENVREVARLMIDSGTQLLPVVEGDSMVGVVTADELLEAV
                                  * :    .        :  .    .  :     *       *..*

1626|gene|hla      ---------------EFWRVRDETAAAAQVDAARK------------------GRKTPYD
3172|gene|hwa      LENLDAISVEDIFTDDVVDVAEQSPLGEAINKLREHSISRVPVVEQDESSSLTGILTTHD
8170|hp|hbo        LDNLDAISVEDILTKDVVTIGEKSHVGQAINRLRENGISRLPVT--DEDGKLTGVLTTHD
4504|gene|nph      LDNLDVLTVDQIHTEEVVTLREDDTLGKAINHLRENAISRLPVV--NDNGKLTGIITTHD
1663|chp|nrc1      LANLDALDVRDIYTEHVVTVDEDDSMGRVINLLREHGISRLPVV--DDAGLLSGIVTRYD
2607|gene|hut      IDNLDALTVEQIFTGDVVTATEDTEVGQVINKLREHGISRVPVL--NDDGKLTGMVTRHD
11525|hp|hma       LDNLDALSVEDIYTRDVITVSEDTNVGQVVNLLRKHGISRLPVL--GDDDGLTGMVTRHD
2097|gene|hhi      LDNLDALSVEDIYTRDVITVSEDTNVGQVVNLLRKHGISRLPVL--GDDDGLTGMVTRHD
3545|gene|hla      QSFLSAVTVADAYTEKLISAAPDTTIGKALNTLREGRIAHLPVV--DD-GEAVGMVSLYD
30750|hp|hbo       QPFLDVATVGDVYTDELVSVESETTAGEAVTRFREHHITHLPVV---EDDAAVGILSLYD
2894|gene|nph      QSFLEAATVGDAYSEELISIEPQTSFGKALHSFRDNRIAHLPVV---DEGSAVGVVSLYD
                                   .     .   .  :   *.                  *  : :*

1626|gene|hla      DVD-ALRHLDASLG----------------------------------------------
3172|gene|hwa      IIDFVVRDDDRQGRGD-------------------------RSGDLDRMLDLPVYDLMSA
8170|hp|hbo        IIEFSVRNADRQGRGD-------------------------RRGDLDRMLDLPVYDLMSS
4504|gene|nph      IADFAVRKMDRQRTGD-------------------------RRGDTERMLDLPVYDAMNS
1663|chp|nrc1      IVDFVVRDTEKTTVGD-------------------------RSGEIERLLDLPVSDEMTS
2607|gene|hut      IVDVVVRDMDKATTGE-------------------------RAGDVDRVLDLPVYDVMSS
11525|hp|hma       IVDVVVRDMNKTTRGD-------------------------RSGEIERVLDMPVYDVMSS
2097|gene|hhi      IVDVVVRDMNKTTRGD-------------------------RSGEIERVLDMPVYDVMSS
3545|gene|hla      IVDFTTRGGTKSQGGSPGN---FGG----RHGGERHGGLGAREGDSDRMLDLPVRNLMSD
30750|hp|hbo       MVDLTVHSGTQSQGGDATGADAFGG--GGTAGRTHRGGYGAREGELARLFDLPVRDVMVS
2894|gene|nph      VTDIAVRATTQSQGGDAGGTDPFGGEISSSSGRARRGGFGAREGERDRLLDLPVRDVMVT
                     :   .                                                     

1626|gene|hla      -VVSSNQQATVDAVLDHF---GLSGRFEVAYGREPSIASLSRKKPSPY---YIERALEDL
3172|gene|hwa      PVITAQPNEPVSDAVKRMFDNDISGVVVTPAAGDTTIEGVLTKTDVLRALTFTEEESMDV
8170|hp|hbo        PVITATPGEKIDTVVSRMFDNDIEGVVVTPTDSDTEVLGILTKTDVLRALTFTEEERMDV
4504|gene|nph      PVQTISAEASVRDAVERMFENDFGGLVVTPDDNDEFVAGILTKTDVLRALTYTEEESMDV
1663|chp|nrc1      PVKTASFDDSVRDAVDDMLAHDYSGVIVTPDDDERAVGGILTKTDVLRALSYTEEEHLDV
2607|gene|hut      PVATTTIDESVEDAVRRMLENDYAGLVVTPERDDSLVAGIITKTDVLRALSFTEEEHMDV
11525|hp|hma       PVETAKLGDSVEDAVARMLENDFAGLVVTPEDDDTHVAGILTKTDVLRALTYTEEEHMDV
2097|gene|hhi      PVETAKLGDSVEDAVARMLENDFAGLVVTPEDDDTHVAGILTKTDVLRALTYTEEEHMDV
3545|gene|hla      VVVTVRRSAPLDEVVETMFEREISSLVVLGDQSSEPI-GVVTKTDVLEALTWEQEDRNAV
30750|hp|hbo       PVRTIRPDETLETAVEAMFETDGSSLVVVEDDCPV---GIVTKTDILDSLTWETGGNRAV
2894|gene|nph      PVRTVTPDETLEDAVAAMFDAGVSSLVVTRDGEPD---GILTKTDILDALTWEAEGNRAV
                    * :      :  .:  :      . .           .:  *.       :       :

1626|gene|hla      GAETAIFVGDNESDVLAADNAGIDSAF----VRRPHRRSTE----------LSCQPTYEI
3172|gene|hwa      QITNIGLLETLTRTEIVESITAVVDKYQQMQVLHAHVRLHEHKEKLRGTPLMQCQIRLRT
8170|hp|hbo        QITNIGLLETLTRDSVVDSITKVVDKYQQMQVHHAHVRFHEHKEKLRGTPLIQSQVRLRT
4504|gene|nph      QITNIGLLDGISREAVRESITEVADKYKDMQVHHAHVRFTEHKERMRGTPLIYCQIRLRT
1663|chp|nrc1      QITNIDLLDTLSRQEVRERIENVVAKYGDMDVHHAHVRLSKHKEKLRGTPLIQSQIRLRT
2607|gene|hut      QITNINLLDTLSRQDVRVGIEDVADKYQAMQVQHAHVRFQEHKEKLRGTPLINCQIRLRT
11525|hp|hma       QITNIKLLDTISRADIRSDIETVADKYGAMQVQHAHVRFHEHKEKLRGTPLIQCQIRLRT
2097|gene|hhi      QITNIKLLDTISRADIRADIEAVADKYGAMQVQHAHVRFHEHKEKLRGTPLIQCQIRLRT
3545|gene|hla      QVFGLDLLDGMDYDGVSALIENMTSKYGDMSVIKASIELHEHKEQSRGMPLVLARIRLVT
30750|hp|hbo       QVYGTDLLGDVSYDDIVSMVEAFDDKDHGMNVLDAKVHLHEHDEKRRGTPLVLARIRLYT
2894|gene|nph      QLYGSDLLDDMNYDEVVSMIDAFDDMDGGTNVLDAKIHLHEHNETRRGTPLLLARIRLYT
                         ::       :      .        *  .     :          : ..     

1626|gene|hla      DD---------------LHDLVSICGRTPV----------DTDEKI--------------
3172|gene|hwa      SLGQVAGSGEGYGAENAFYVALDKLERNVLEMKGV-----NADERYRGQLIRKL------
8170|hp|hbo        SHGQVAGSGEGYGAEHAFHVALDKLERNVLELKGV-----NADEKYQGQVMRKL------
4504|gene|nph      NRGQIAGSGEGYGSKTAFRVAVDKLERNVLELKGI-----RADEEYKGQLLRKL------
1663|chp|nrc1      NKGQIAGTGEGYGADNSFHVALDKLERNVLELKGI-----EHDEEYEGQLLRKL------
2607|gene|hut      NKGQVAGTGEGYGSKTAFNVALDKLQRNVLERKGV-----RSDEEYRGQLLRKL------
11525|hp|hma       NKGQAAGSGEGYGAETAFNVALDKLERNVLELKGV-----QADEEYRGQLLRKL------
2097|gene|hhi      NKGQAAGSGEGYGAETAFNVALDKLERNVLELKGV-----QADEEYRGQLLRKL------
3545|gene|hla      DRGYFTADGEGYGASHALRLAANKVERQILKGKTYRRSKKRPDSREQETLYGWWLTGDSF
30750|hp|hbo       DSGLYIASGEGYGARQALNEACDIVERQIRDEKTYGRSKKHPDEAFWEKRFGWI------
2894|gene|nph      DGGLFMASGEGYGASHALGEAKDTLERRIRDNKTYAQTKKHPDEEFWDKRFGWW------
                   .                :    .   *               *.                

1626|gene|hla      ---------
3172|gene|hwa      ----GEL--
8170|hp|hbo        ----GDL--
4504|gene|nph      ----NEL--
1663|chp|nrc1      ----NDL--
2607|gene|hut      ----GEL--
11525|hp|hma       ----GEL--
2097|gene|hhi      ----GEL--
3545|gene|hla      DFPEGNE--
30750|hp|hbo       ----LEEAA
2894|gene|nph      ----LES--