HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0759COG3427arCOG01927Uncharacterized conserved proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0759 nrc1 VNG0769 vng769 no entry
cHOG0759 hmu HMUK2340 Hmuk_2340 conserved hypothetical protein
cHOG0759 hma RRNAC0811 hypothetical protein
cHOG0759 hwa HQ2349A hypothetical protein
cHOG0759 hla HLAC0690 Hlac_690 hypothetical protein
cHOG0759 hbo HBOR20550 Hbor_20550 uncharacterized conserved protein
cHOG0759 hut HUTA0002 Huta_0002 conserved hypothetical protein
cHOG0759 hvo HVO_1187 HVO_1187 conserved hypothetical protein
cHOG0759 nph NP0376A hypothetical protein
cHOG0759 hhi 1455 HAH_1455 polyketide cyclase/dehydrase
MUSCLE (3.6) multiple sequence alignment


10811|hp|hma       MTVRVERTMTVPATPERVWEFITDPDKRARPISVVTDWEIIDDTH--------ANWSIEL
1455|gene|hhi      MTVRAERTMTVPATPERVWEFITDPDKRARPISVVTDWEVIDDTH--------ANWSIEL
2|chp|hut          MSIRLEQVIEVSATPEEVWRFIADPEQRAKYISVVEDYTVDGDRS--------ATWEISL
376|hp|nph         MTVRVERVFDIPVPPEGVWSVIADPKTRAESISVVEEYETTGDRT--------AVWHVSL
769|hp|nrc1        MTVRVERTFELAVPPEDVWAFISDPEKRADAISVVDSYTTTGDTT---------TWHVEL
690|hp|hla         MTVRVSRTFEFDAPAEDVWAFISDAEQRAEAISVVDTFEVHGDGR--------ATWHVAL
2349|hp|hwa        MTVRVRRVFEFTVPPSDVWKFIADPSKRADAISVVDTYEVDTTNTDSDDVPISATWEVAL
20550|hp|hbo       MTVRVRRAFEFDAPPADIWEFIADPRNRAEAISVVEKYDVEPNTNE-------VTWHVSL
                   *::*  ..: . ...  :* .*:*.  **  ****  :                 * : *

10811|hp|hma       PIPVVSQTMTVKTEDVEQRRPEYARFIGRSKVMTVQGEHELEETADG-GTKLTNRFIVDG
1455|gene|hhi      PIPVVSQTMTVKTEDVEQRRPEYARFIGRSKVMTVQGEHELEETADG-GTKLTNRFIVDG
2|chp|hut          PIPVINRTITVETEDVERREPEFVKFVGRSKAVRVVGEHELTPTETG--TRLTNTFTVEG
376|hp|nph         PIPRVDRTIRIETEDIERDEPEYVKFTGRSKAMYVQGEHELEPTDEG--TRLTNRFVVDG
769|hp|nrc1        PIPVVRRTIDVETRDVDVRPPTFVKFIGKSGMFDVTGEHEIEPADAG--STLTNRFVVDG
690|hp|hla         PIPMIKSTISVETEEVKREPPTRVKFVGKSRAFRVTGEHTITEIDGG--CQLANEFVVDG
2349|hp|hwa        PIPLINSTATVNTEDVDRDPPTHVKFVGKSSVMNVTGEHTIEHDEPNQTTRLINEFVVDG
20550|hp|hbo       PIPILNSTVAIKTNDVERNPPRFVRFVGKSKVMRVSGEHTVEETETG--SRLTNEFVVDG
                   *** :  *  ::* ::.   *  ..* *.*  . * *** :     .    * * * *:*

10811|hp|hma       KLPGVERFFKRNLDDEMQNLEQALRDDLEVEV----
1455|gene|hhi      KLPGVERFFKRNLDDEMQNLEQALRDDLEVEA----
2|chp|hut          RIPGVERFFKKNLEAEFENLRDGLDAYLDGE-----
376|hp|nph         RLPGVETYFKRKLDDELANLEAVVLESVNTEGTDDG
769|hp|nrc1        SVPGVEQFFKRNLDDELDRLQRKLADA---------
690|hp|hla         RLPGVESFFERNFDAELDNLEDALRASFGTTA----
2349|hp|hwa        RVPGVERYFKRNLDDELDNLESALRRSFEA------
20550|hp|hbo       RVPGVERFFKRNLDRELENLEAALRETV--------
                    :**** :*:.::: *: .*   :