HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0758COG2007KOG3283 KOG3163arCOG04154Ribosomal protein S8E30S ribosomal protein S8E

HOG Organism Gene ID Name Annotation
cHOG0758 nrc1 VNG1668 rps8e 30S ribosomal protein S8E
cHOG0758 hmu HMUK1797 Hmuk_1797 ribosomal protein S8e
cHOG0758 hma RRNAC1511 rps8E 30S ribosomal protein S8e
cHOG0758 hwa HQ3309A rps8R 30S ribosomal protein S8e
cHOG0758 hla HLAC1967 Hlac_1967 ribosomal protein S8e
cHOG0758 hbo HBOR08040 Hbor_08040 SSU ribosomal protein S8E
cHOG0758 hut HUTA0917 Huta_0917 ribosomal protein S8e
cHOG0758 hvo HVO_2373 HVO_2373 ribosomal protein S8.e
cHOG0758 nph NP4798A rps8R 30S ribosomal protein S8e
cHOG0758 hhi 2081 rps8E 30S ribosomal protein S8e
MUSCLE (3.6) multiple sequence alignment


4798|gene|nph       -MNHARSTKKRTGGRRRAVRKKRKHELGSAPTETQVGDQKLKVVETHGGNAKVRAVAKNT
917|gene|hut        MKFQGRSTRKRTGGRRRHARNKRRHELGDEPTETEVGEQKLKFVDARGGTEKIRAIVTDV
1668|gene|nrc1      MQYQGRSKRSKTGARLRPRSKKSKSELGREPTETTVGEPRFRTVDVRGDAEKVRVLSTNV
11511|gene|hma      MKDQGRSPRKRTGGRRRPNHKKKKHELGKDTVETQVGEQRLKTVDSRGNTQKVRAVKTDV
2081|gene|hhi       MKDQGRSPRKRTGGRRRPNHKKKKHELGKDTVETQVGEQRLKTVDSRGNTQKVRAVKTDV
3309|gene|hwa       MKDQGRSTRKRTGGRLHDVSKKKRHQLGREPAETTVDDPRFQVIDARGSDDKLRALSTNI
1967|gene|hla       MKDQGRSTRKRTGGRLKHASNKKRHQLGREPAETTVGETRVQYIDSRGNEKKVRALSTNV
8040|gene|hbo       MKDQGRSKRKRTGGRLRPSHKKKRYQLGREPTETTVGEPRFRVVDSRGNQKKLRALSTNV
                       :.** ...**.* .   :* . :**  ..** *.: ... :: .*.  *:*.: .: 

4798|gene|nph       ASVATDDGVEPATIEDVAENPSNPNYVRRNIITKGAIIETDMGRARVTSRPGQDGQVNAV
917|gene|hut        ASVATDDGTVAAEIENVVENPANPNYVRRNIITKGAVVATSEGEARVTSRPGQDGQVNAE
1668|gene|nrc1      VNVATDSGAERATIEDVSANDANPNYARRNIITKGAIIETDAGTARVTSRPGQDGQVNAT
11511|gene|hma      ASIADGAETIEATIENVVENPSNPNYARRNIITKGAILETSEGQARVTSRPGQHGQVNAV
2081|gene|hhi       ASIADGAETIEATIENVVENPSNPNYARRNIITKGAILDTSEGQARVTSRPGQHGQVNAV
3309|gene|hwa       AQVADSGEVTTEEIENVVDNPANVNYIRRNIITKGAIIETSAGQARVTSRPGQTGQVSAV
1967|gene|hla       AQVADGDAVSEAEIENVVDNPSNVNYARRNIITKGAIIETSAGRARVSSRPGQTGQVNAV
8040|gene|hbo       AQVADGGDVSEAEIENVVDNPSNVNYIRRNIITKGAIIETSAGRARVTSRPGQDGQVNAV
                    ..:* .  .    **:*  * :* ** *********:: *. * ***:***** ***.* 

4798|gene|nph       LVDE-
917|gene|hut        VLE--
1668|gene|nrc1      RVDE-
11511|gene|hma      LVE--
2081|gene|hhi       LVE--
3309|gene|hwa       LLEDS
1967|gene|hla       LID--
8040|gene|hbo       LVDEE
                     ::