HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0757COG0089KOG1751arCOG04072Ribosomal protein L2350S ribosomal protein L23P

HOG Organism Gene ID Name Annotation
cHOG0757 nrc1 VNG1691 rpl23p 50S ribosomal protein L23P
cHOG0757 hmu HMUK1830 Hmuk_1830 Ribosomal protein L25/L23
cHOG0757 hma RRNAC1609 rplW 50S ribosomal protein L23
cHOG0757 hwa HQ2840A rplW 50S ribosomal protein L23
cHOG0757 hla HLAC2447 Hlac_2447 Ribosomal protein L25/L23
cHOG0757 hbo HBOR10250 Hbor_10250 LSU ribosomal protein L23P
cHOG0757 hut HUTA2294 Huta_2294 Ribosomal protein L25/L23
cHOG0757 hvo HVO_2562 HVO_2562 rplW ribosomal protein L23
cHOG0757 nph NP4858A rplW 50S ribosomal protein L23
cHOG0757 hhi 2152 rplW 50S ribosomal protein L23
MUSCLE (3.6) multiple sequence alignment


2447|gene|hla       ---MNSIIEHPIVTEQAMNEMDFKNKLLFLVDIDATKPEVREEVQDRYDVSVVDVNTQVT
10250|gene|hbo      ----MSVVHHPLVTEKAMNEMDFDNKLQFIVDLDAAKPEIVEEIESRYEVSIEKVNTQVT
1691|gene|nrc1      ---MSSIIDYPLVTEKAMDEMDFQNKLQFIVDIDAAKPEIRDVVESEYDVTVVDVNTQIT
2840|gene|hwa       ---MSSLIEYPLVTEKAMDEMDFDNKLQFIVDTDATKDEIENEIESRYEITIIDTKTQIT
2294|gene|hut       MTDPIDVIDHPHVTEKAMDKMDFQNKLQFIVKIDATKDDIREAVEQQFDVTVDNVNAQVT
4858|gene|nph       -----MTIKHPLVTEKAMNDMDFENKLQFVCHPEATKGDIAAAVESQFDVEVDSINTQVR
11609|gene|hma      --MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNT
2152|gene|hhi       --MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNT
                           : :* ***:**:.***.*** *     *:* ::   ::. ::: : . ::*  

2447|gene|hla       PQGGKKAIVTLSEDDDATEIASRIGVF
10250|gene|hbo      PKGTKKATVRLSEDDDAQEVASRIGVF
1691|gene|nrc1      PEAEKKATVKLSAEDDAQDVASRIGVF
2840|gene|hwa       PRAKKKATVRLSDDDDAQDIASRIGVF
2294|gene|hut       MNGNKKAEVTLSADDDAEEVASRIGVF
4858|gene|nph       MDGDKKAIVELSADDDAQEVASRIGVF
11609|gene|hma      MDGEKKAVVRLSEDDDAQEVASRIGVF
2152|gene|hhi       MDGEKKAVVRLSEDDDAQEVASRIGVF
                      . *** * ** :*** ::*******