HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0756arCOG04602hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0756 nrc1 VNG0677 vng677 no entry
tucHOG0756 hmu HMUK2905 Hmuk_2905 conserved hypothetical protein
tucHOG0756 hma RRNAC0767 hypothetical protein
tucHOG0756 hwa HQ2355A hypothetical protein
tucHOG0756 hla HLAC1177 Hlac_1177 hypothetical protein
tucHOG0756 hbo HBOR20990 Hbor_20990 hypothetical protein
tucHOG0756 hut HUTA2970 Huta_2970 conserved hypothetical protein
tucHOG0756 hvo HVO_1142 HVO_1142 conserved hypothetical protein
tucHOG0756 nph NP1676A hypothetical protein
tucHOG0756 hhi 1414 HAH_1414 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1177|hp|hla       MSDTTGDEPGEEDGIDARYEETDGERRLTFSA--NGREATVAQNVEGYAMLKVRPGPTGD
677|hp|nrc1       MTDDP-AATAEADGITAQYYETDAERVLAFTVE-RGTTAAIAQNVEGYAMLKVRSSPDGD
2355|hp|hwa       MSAHE----TEADGIVARYRETETERVLEFESETGGQTAAVAQNREGYAMLKVRPNANGD
1676|hp|nph       MSTVE------EGDITAQYRETDEERVLEFEA--GGKTAAVAQNIDGYAMLKVRPSADGD
10767|hp|hma      MTDSELPVEASADGITATYRETDEERLLIFES--NGGSAAVAQNIEGYAMLKVRPTADGD
1414|hp|hhi       MTDSELPVEASADGITATYRETDEERLLTFES--DGGSAAVAQNIEGYAMLKVRPTADGD
20990|hp|hbo      MTETE----ATANGITAKYYETESERILTFDN--GRTTAAIAQNREGYAMLKVRPTADGD
2970|chp|hut      MTATE----RTADGITATYEETDAERVLVFEV--NGQTAAIAQNREGYAMLKVRPTADGD
                  *:          ..* * * **: ** * *        *::*** :********. . **

1177|hp|hla       ELERYYGFDMALDHAAELLGVAVADLPVPEAAADMGM
677|hp|nrc1       ELERYYGFDMALDHAAERLGVGKHDLPVPAGAADMGM
2355|hp|hwa       ELERYYGFDMALDHAAELLRVNVHDLPIPEPASDMGM
1676|hp|nph       ELERYYGFDMAIDHAAELLDVAPSELPIPEPAADMGM
10767|hp|hma      ELERYYGFDMALDHAAELLGVSPNVLPVPDPAADMGM
1414|hp|hhi       ELERYYGFDMALDHAAELLGVSPNVLPVPEPAADMGM
20990|hp|hbo      ELERYYGFDMALDHAAELLGVSPHDLPVPEDAEDMGM
2970|chp|hut      ELERYYGFDMALDHAAELLGVDPAQLPIPESAEDMGM
                  ***********:***** * *    **:*  * ****