HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0755COG0139KOG4311arCOG02676Phosphoribosyl-AMP cyclohydrolaseN1-(5-Phospho-D-ribosyl)-AMP 1.6-hydrolase

HOG Organism Gene ID Name Annotation
cHOG0755 nrc1 VNG2284 hisJ N1-(5-Phospho-D-ribosyl)-AMP 1.6-hydrolase
cHOG0755 hmu HMUK0854 Hmuk_0854 Phosphoribosyl-AMP cyclohydrolase( EC:3.5.4.19 )
cHOG0755 hma RRNAC2524 hisI2 phosphoribosyl-AMP cyclohydrolase
cHOG0755 hwa HQ1022A hisI phosphoribosyl-AMP cyclohydrolase
cHOG0755 hla HLAC2182 Hlac_2182 phosphoribosyl-AMP cyclohydrolase
cHOG0755 hbo HBOR02530 Hbor_02530 phosphoribosyl-AMP cyclohydrolase( EC:3.5.4.19 )
cHOG0755 hut HUTA1781 Huta_1781 Phosphoribosyl-AMP cyclohydrolase
cHOG0755 hvo HVO_2992 HVO_2992 phosphoribosyl-AMP cyclohydrolase
cHOG0755 nph NP5154A hisI phosphoribosyl-AMP cyclohydrolase
cHOG0755 hhi 2954 hisI2 bifunctional phosphoribosyl-ATP pyrophosphatase/phosphoribosyl-AMP cyclohydrolase
MUSCLE (3.6) multiple sequence alignment


5154|gene|nph       ------------------MSVDLAF-------DEQELLPAVAQDAESGDVLMLAYVSEEA
1781|gene|hut       MRGDAFSSGMVASDAHDVPDVDLAF-------EDNEYLPAVAQDAESGDVLMLAYVTREA
12524|gene|hma      -----------------MTDVDLAF-------DEQEYIPAVAQDADSGDVLMLAYVTEEA
2954|gene|hhi       -----------------MTEVDLAF-------DEQEYIPAVAQDADTGEVLMLAYVTEEA
1022|gene|hwa       ------MTDDAVTGSQDDAEIEIRF-------NSDGLVPAIAQDADSGEVLMLAYVSPTA
2284|gene|nrc1      ---------------MEEFDVDLDFGGAGHTDDGDGLVAVIAQDADSRDVLMLAYATREA
2182|gene|hla       ----------MTDADADQGAIEVDF-------GDDGLVPAVAQDADSGEVLMLAYVSPEA
2530|gene|hbo       ----------------MTEDVEVDF-------GDDGLVPAVAQDADSGEVLMLAYVSPEA
                                        ::: *         :  :..:****:: :******.:  *

5154|gene|nph       VARSRETGYAHYYSRSREELWKKGGSSGHTQEIEEIRVDCDGDAILYLVEQAGGACHTGY
1781|gene|hut       LDRTRETGLAHYYSRSRDELWQKGETSGNVQHLKEIRVDCDGDALLYVIEQDGGACHTGF
12524|gene|hma      LRKTRETGEAHYYSRSRDELWHKGGTSGHTQAVKEVRVDCDGDALLYIVDQTGGACHTGY
2954|gene|hhi       LRKTRETGEAHYYSRSRDELWHKGGTSGHTQAVEEVRVDCDGDALLYVVDQTGGACHTGY
1022|gene|hwa       LKRTRETGQAHYYSRSREELWKKGETSGHTQHIREIRADCDADTILYLVEQTGGACHTGH
2284|gene|nrc1      VARTATTGRAHYYSRSRDELWEKGATSGNTQSVDEIRVDCDGDALLYLVAQTGGACHTGH
2182|gene|hla       LERTRETGEAHYYSRSRDELWHKGGSSGHTQEVREVRVDCDADTLLYLVDQNVGACHTGH
2530|gene|hbo       LERTRETGRAHYYSRSRDELWEKGATSGHTQSVEEVRVDCDADTLLYLVEQTGGACHTGR
                    : .:  ** ********:*** ** :**:.* : *:*.***.*::**:: *  ****** 

5154|gene|nph       DTCFHRTLDGDIVGEQVFDPEEIYE
1781|gene|hut       QSCFHRTIDGEVVGERVFDPDDVYE
12524|gene|hma      ESCFHRTVDGETVGEQVFDPDDVY-
2954|gene|hhi       ESCFHRTVDGETVGEQVFDPDDVY-
1022|gene|hwa       QSCFYRTLDGTEVTERVFDPETVYE
2284|gene|nrc1      ESCFHRTLDGDTVGDQVFDPDDAY-
2182|gene|hla       RSCFYRTVDGEHVGERVFDPDEVY-
2530|gene|hbo       RSCFYRTIDGDEVGKTVFDPDDVY-
                     :**:**:**  * . ****:  *