HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0754COG2023KOG4394arCOG04345RNase P subunit RPR2hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0754 nrc1 VNG0599 vng599 no entry
cHOG0754 hmu HMUK1998 Hmuk_1998 RNAse P, Rpr2/Rpp21 subunit( EC:3.1.26.5 )
cHOG0754 hma RRNAC1349 rnp RNAse P Rpr2/Rpp21 subunit
cHOG0754 hwa HQ2501A rnp4 ribonuclease P protein component 4
cHOG0754 hla HLAC0943 Hlac_943 RNAse P, Rpr2/Rpp21 subunit
cHOG0754 hbo HBOR20730 Hbor_20730 ribonuclease P protein subunit Rpp21( EC:3.1.26.5 )
cHOG0754 hut HUTA0089 Huta_0089 RNAse P, Rpr2/Rpp21 subunit
cHOG0754 hvo HVO_1167 HVO_1167 RPR Ribonuclease P protein component 4
cHOG0754 nph NP4480A rnp4 ribonuclease P protein component 4
cHOG0754 hhi 1938 rnp RNAse P Rpr2/Rpp21 subunit
MUSCLE (3.6) multiple sequence alignment


11349|gene|hma      --MTDEATIARERIERLQSLAREAVQAGNEERARSYVRRARRVAERHRLRLPRSFERSTC
1938|gene|hhi       --MTDEATIARERIERLQSLAREAVQAGNEERARSYVRRARRVAERHRLRLPRSFERSTC
2501|gene|hwa       ------MSIPAERMKRLHVLAREAVATGKKARARSYVKLARRIGERNRISLPRQFRRFSC
943|gene|hla        ------MGIPSERIDRLFALAREAVVDDEYDRAREYVALARRIAERNRCGVPAEFSRKTC
20730|gene|hbo      ------MSIAEERIERLHGLAREAATEGEFDRSREYVRLARRIAERNRCGLPKSFQRSTC
89|gene|hut         MLMSNDAAIATERIQRLHEAAREAARSGKDQRARSHVRRAKRIAQRHRLSLPDRFDRFTC
599|chp|nrc1        -----MASIAAERIDRLHTLARAAARTGDDDRAREYVRLARRLAERNRLTLPPAFRRFTC
4480|gene|nph       ------MSVAEERLERLHELARDAASDGDDDLARRYVRRARRLAERNRLPLPRRFKRFTC
                            :. **:.**   ** *.  ..   :* :*  *.*:.:*:*  :*  * * :*

11349|gene|hma      DACDTYLLHGHNARSRTQAGHVVIAC-DCGSQSRYPYD--
1938|gene|hhi       DACDTYLLHGHNARSRTQSGHVVITC-DCGSQSRYPYD--
2501|gene|hwa       DNCDIYLRPAKTARVRLQPGHVVIRCLECGATKRYPHE--
943|gene|hla        DDCDVYLRPGKTGRVRLRPGRVVVRCRECGATARYPFD--
20730|gene|hbo      DACDVYLRPGQNARVRVHRGRVIVRCHDCGATERYPFD--
89|gene|hut         ADCGAYLLPGRSARVRTQNGHVVITC-DCGSHARYPYDDQ
599|chp|nrc1        DDCDAVLVPGRNARVRTRSGHVVVTC-DCGTHARYPYTG-
4480|gene|nph       DRCDAYLIPGRNARVRTRNGHLVITC-DCGEHARYPYDG-
                      *.  *  ....* * . *.::: * :**   ***.