HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0753COG0091KOG3353 KOG1711arCOG04098Ribosomal protein L2250S ribosomal protein L22P

HOG Organism Gene ID Name Annotation
cHOG0753 nrc1 VNG1695 rpl22p 50S ribosomal protein L22P
cHOG0753 hmu HMUK1833 Hmuk_1833 ribosomal protein L22
cHOG0753 hma RRNAC1606 rpl22p 50S ribosomal protein L22P
cHOG0753 hwa HQ2837A rpl22p 50S ribosomal protein L22P
cHOG0753 hla HLAC2444 Hlac_2444 ribosomal protein L22
cHOG0753 hbo HBOR10280 Hbor_10280 LSU ribosomal protein L22P
cHOG0753 hut HUTA2297 Huta_2297 ribosomal protein L22
cHOG0753 hvo HVO_2559 HVO_2559 rplV ribosomal protein L22
cHOG0753 nph NP4864A rpl22p 50S ribosomal protein L22P
cHOG0753 hhi 2149 rpl22p 50S ribosomal protein L22P
MUSCLE (3.6) multiple sequence alignment


4864|gene|nph       MGISYSVDVDPDETAKAMLRERHMSHKHSKEIAREIKGKTAGEAVDYLEAVIDGDRSVPF
2297|gene|hut       MGISYSVDADPERTAKAMLRERQMSHKHSKAIAREIKGMIAEEAVAYLEDVIEGDRSVPF
11606|gene|hma      MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPF
2149|gene|hhi       MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPF
1695|gene|nrc1      MGISYSVDVDSEASAKAMLRERSISLKHSKAIAREISGETVADAKEYLQAVIDEERSVPF
2444|gene|hla       MGINYSVEADPETTAKGMLRDRPISVKDSKEISREIKGETVADAEEFLQEVIDEETSVPM
2837|gene|hwa       MGINYSVKADPETTARGMLRDRPISLKHSKAIAREIKGMTIADAESYLDDVIAQRQSVPF
10280|gene|hbo      MGINYSVEADPDTTAKGMLRDRPISLKHSKAISREIKGMTVEDAEEYLDAVIEGERSVPF
                    ***.***..*.: :*..***:* :* * ** *:***.*    :*  :*: **    .**:

4864|gene|nph       KSHNTGVGHRNDIEGWDAGRYPEKASEAFLDLLENGINNADHQGFEGEEMVIEHVAAHKV
2297|gene|hut       KSHNSGVGHRNDIEGWDAGRYPEKASKAFIDLLENAIGNAEYAGMDGESMQIAHVAAHKV
11606|gene|hma      KQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKV
2149|gene|hhi       KQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTITHVAAHKV
1695|gene|nrc1      KQHNSGVGHRNDIDGWDAGRYPEKASKDFLKLLSNVSNNADQQGFDADEMVIEHVAPHKV
2444|gene|hla       RQHSAGAGHRSDIDGWDAGRYPEKAAKDFLKLLENVKNNADEQGFDGDEMVIKHVAPHKV
2837|gene|hwa       RQHNSGVGHRSDIDGWDAGRYPEKASKAFLELIENVASNANEQGFDGNAMAIRHVAAHKV
10280|gene|hbo      RQHNTGVGHRSDIEGWDAGRYPEKASKAFLELLQNVAANADEAGFDGRSMEIMHVAAHKV
                    ..*.:*.**...::***********:: *:.*:.*   **:  *::.  * * ***.***

4864|gene|nph       GESPGQKPRAFGRASPWNTPQVDVELVLRTEDDE----
2297|gene|hut       GEQQGRKPRAMGRANPWNTPEVDVELILEELQEGDA--
11606|gene|hma      GEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED---
2149|gene|hhi       GEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED---
1695|gene|nrc1      GESQGRKPRAMGRATTWNATLCDVEIVVTETEEVTA--
2444|gene|hla       GERPGRNPRAAG-ATQWNTTLADVELIIEDPEADE---
2837|gene|hwa       GERQGRKPRAFGSADPWNTTICDVELIIEQPGTDGVDI
10280|gene|hbo      GERPGRKPRAFGSADPFNTTLCDVELIIEEVEE-----
                    **  *.:*** * *  :*:.  ***:::