HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0752COG0102KOG3204 KOG3203arCOG04242Ribosomal protein L1350S ribosomal protein L13P

HOG Organism Gene ID Name Annotation
cHOG0752 nrc1 VNG1138 rpl13p 50S ribosomal protein L13P
cHOG0752 hmu HMUK2594 Hmuk_2594 ribosomal protein L13
cHOG0752 hma RRNAC0065 rpl13p 50S ribosomal protein L13P
cHOG0752 hwa HQ2939A rpl13p 50S ribosomal protein L13P
cHOG0752 hla HLAC1821 Hlac_1821 ribosomal protein L13
cHOG0752 hbo HBOR12510 Hbor_12510 LSU ribosomal protein L13P
cHOG0752 hut HUTA2519 Huta_2519 ribosomal protein L13
cHOG0752 hvo HVO_2778 HVO_2778 rplM ribosomal protein L13
cHOG0752 nph NP2838A rpl13p 50S ribosomal protein L13P
cHOG0752 hhi 824 rpl13p 50S ribosomal protein L13P
MUSCLE (3.6) multiple sequence alignment


1821|gene|hla       MSLAKIDADVVVDARDCILGRVSSKVAQRVLDGETVAVVNAERAVITGNEEATMETYHTR
10065|gene|hma      MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKR
824|gene|hhi        MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQITEKYKKR
2519|gene|hut       MSIATIDADVVVDARDCIMGRVASQVAERALDGETIAVVNAERAVITGSDDDVYGTYKTR
2939|gene|hwa       MSLAEFDADVVINAQNCIVGRVASEVAQRALGGETVAIVNVEDAVITGSEEDVMSVYETR
1138|gene|nrc1      MSLAEFDADVVVDARDCIMGRVASNVAERALAGDRVAVVNAEQAVITGTEDDVFSTYRTR
12510|gene|hbo      MSLAEFDADVVVDARNCILGRVASEVAQKALAGEKVAIVNAEDAVITGSEDDVMGVYRKR
2838|gene|nph       MSYAEFDADVVIDARDCILGRVASQVAERALDGERIAVVNAEQAVITGSEDDIMEVYRKR
                    ** * :****:::*.:**:***:*:**:..* *: :*:**.* ***** ::     * .*

1821|gene|hla       AELGSDSGPYYPKRPDRIFKRAIRGMLPYKTEDGREALSNVRVYVGNPYERDE-DAETVV
10065|gene|hma      VDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDG-E----V
824|gene|hhi        VDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFENVRVYLGNPYDEDG-E----V
2519|gene|hut       TDVGSDRGPAYPTRPDGIFKRAIRGMLPYKKPRGREALENVRVYLGNPYEEDEPD----V
2939|gene|hwa       SELGSDQGPAYPSRPDGIFKRAVRGMLPYKSDRGREALSNVRTYVGNPYDDDG-E----A
1138|gene|nrc1      ANLGSDRGPYYPKRPDGIFKRAIRGMLPYKQDDGREALDSVRVYVGNPMDEDG-D----V
12510|gene|hbo      VEVGSDQGPYYPKRPDRIFKRAVRGMVPYKTDKGREALSNVRVYVGNPFDEDG-D----V
2838|gene|nph       DEVGSDRGPRYPKRPDRIFKRSVRGMLPYKTTRGREAFENVRIYMGNPYEEAE------V
                     ::*.* *  **.*** ****::***:*:*   ****:..** *:*** :         .

1821|gene|hla       LDGTSLDRLSNIKFTTLGDISESLGANVTW
10065|gene|hma      LDGTSLDRLSNIKFVTLGEISETLGANKTW
824|gene|hhi        LDGTSLDRLSNIKFVTLGEISETLGANKTW
2519|gene|hut       LEGTSLDRLSNIKFVQLGELSEDLGANVTW
2939|gene|hwa       IDGTTLDRLSNIKFLSLGEVSANLGATVTW
1138|gene|nrc1      LDGTSLDRLSTIRFVTLSEVSEELGANVTW
12510|gene|hbo      LDDTSLDRLSNIKFIALGEVSEKLGANVTW
2838|gene|nph       LEDTSLDRLSNIKFVSLGEVSENLGANVTW
                    ::.*:*****.*.*  *.::*  ***. **