HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0075COG1146arCOG04548Ferredoxinferredoxin

HOG Organism Gene ID Name Annotation
cHOG0075 nrc1 VNG2496 ferB ferredoxin
cHOG0075 hmu HMUK2612 Hmuk_2612 4Fe-4S ferredoxin iron-sulfur binding domain protein
cHOG0075 hma RRNAC0089 ferB ferredoxin
cHOG0075 hwa HQ3667A ferB ferredoxin II
cHOG0075 hla HLAC2321 Hlac_2321 4Fe-4S ferredoxin iron-sulfur binding domain protein
cHOG0075 hbo HBOR00650 Hbor_00650 ferredoxin
cHOG0075 hbo HBOR11980 Hbor_11980 NADH:ubiquinone oxidoreductase chain I-like protein
cHOG0075 hut HUTA0541 Huta_0541 4Fe-4S ferredoxin iron-sulfur binding domain protein
cHOG0075 hvo HVO_0211 HVO_0211 ferB ferredoxin
cHOG0075 nph NP3692A ferB ferredoxin II
cHOG0075 hhi 846 fdx1 ferredoxin
MUSCLE (3.6) multiple sequence alignment


3667|gene|hwa       -----MGIDPNFDRNREVVDEENGVEVWGPTEPPEQLGIHGTHVAVDYDICIADGACLDS
650|gene|hbo        -----MGIDPNFDQNRERVGEENDVPVWGPVEPPEKLGIHGTHVAVDYDICLADGACLEN
3692|gene|nph       -----MAIDPNFEETREREGQERGVDVWGPTDPPEQLGIHGTHVAVDLDICVGDGACLED
2321|gene|hla       -----MAIDSNFEQNREKVGEEDGVAVWGPVEPPEKQGIRGTHVAVDFDICLADGACLED
11980|gene|hbo      MLPHTMPIDPNFETNCKPVDEEDGVTVWGPVDPPEKLGIHGTHVAVDFDICIGDGACLED
10089|gene|hma      -----MAIDPEFEENRDVVEQHDGHNVWGPVDEPEELGIHGTHVAVDFDICIADGACLED
846|gene|hhi        -----MAIDPEFEENRDVVEQHDGHDVWGPVDEPEELGIHGTHVAVDFDICIADGACLED
2496|gene|nrc1      -----MAIDPQFTENRAQVDTHKGHDVWGPVEEPEKLGVHGTHVAVDFDICLADGACLED
541|gene|hut        -----MPIDPEFAQNRDVVDEHEDHDVWGPVEEPETLGIHGTHVAVDFDICLADGACLED
                         * **.:*  .        .  ****.: **  *:.******* ***:.*****:.

3667|gene|hwa       CPVDVFTWVETPGHPQSDRKVEPSHEAQCIDCMLCVDICPVDAIDVDGSRT---
650|gene|hbo        CPVDVFTWVDTPDHPVSEQKVEPTREDQCIDCMLCVDICPVDAIDVDASRA---
3692|gene|nph       CPVDVFEWIDTPDHPESEQKVTPADEDQCIDCMLCVDVCPVDAIDVDPGRENRI
2321|gene|hla       CPVDVFEWVDTPGHPESERKASPVDEDQCIDCMLCVDVCPVDAIDVDPGRENRI
11980|gene|hbo      CPVDVFSWVDTPGHPESEVKVQPAREDQCIDCMLCVDVCPVDAIDVDPGRAGRV
10089|gene|hma      CPVDVFEWVDTPDHPESEIKADPAHEDQCIDCMLCVDVCPVDAIDVDPGRAGRI
846|gene|hhi        CPVDVFEWVDTPDHPESEIKADPAHEEQCIDCMLCVDVCPVDAIDVDPGRAGRI
2496|gene|nrc1      CPVDVFEWVETPDHPESERKADPANETQCIDCMLCVDVCPVDAIDVDAGRA---
541|gene|hut        CPVDVFEWVETPGHPESERKADPANETQCIDCMLCVDVCPVDAIDVNPARADD-
                    ****** *::**.** *: *. *  * **********:********: .*