HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0746arCOG04630hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0746 nrc1 VNG1403 vng1403 no entry
tucHOG0746 hmu HMUK2230 Hmuk_2230 conserved hypothetical protein
tucHOG0746 hma RRNAC1065 acs1 acyl-coenzyme A synthetase
tucHOG0746 hwa HQ2999A hypothetical protein
tucHOG0746 hla HLAC1478 Hlac_1478 hypothetical protein
tucHOG0746 hbo HBOR13610 Hbor_13610 hypothetical protein
tucHOG0746 hut HUTA0413 Huta_0413 conserved hypothetical protein
tucHOG0746 hvo HVO_2850 HVO_2850 conserved hypothetical protein
tucHOG0746 nph NP3442A hypothetical protein
tucHOG0746 hhi 1675 HAH_1675 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


10650|gene|hma      MSEQDHVDSIVHEPSHSFVESTNVWEFMQEYDIDNYDELIERTTTDLPEEPDSGVEWFWD
1403|hp|nrc1        ----------------------------------------------MSGYGTLHADW---
3442|hp|nph         ------------------------------------MKRSAVSDDSTPDPSTLGDGW---
13610|hp|hbo        ---------------------------------------MTDETADSPTTAEPPGGW---
413|chp|hut         ------------------------MPRYTRGDDSKRDVLASRDRTESVTIAELPTGW---
1675|hp|hhi         -----------------------------------------------MDLSALPEDW---
2999|hp|hwa         -----------------------MSDHESTTETDPKGHAEEIEASQSDGATDPPIGW---
1478|hp|hla         -----------------------------------------------MSFEALPDGW---
                                                                            *   

10650|gene|hma      LLPEYLDIEFFDAYDQVRDNSEGPQFTDWYAGGTINAAHNVLDRHAARDSPTRNTVALIW
1403|hp|nrc1        ---------------------------------------------------------TVW
3442|hp|nph         ---------------------------------------------------------DIW
13610|hp|hbo        ---------------------------------------------------------TLW
413|chp|hut         ---------------------------------------------------------EVW
1675|hp|hhi         ---------------------------------------------------------TVW
2999|hp|hwa         ---------------------------------------------------------QIW
1478|hp|hla         ---------------------------------------------------------RVW
                                                                              :*

10650|gene|hma      EGEPGDVREITYHELNRQASKVANYLESVGVGTGDTVGLYMPMVPEVASILYGCLKVGAI
1403|hp|nrc1        TEDATAGDVVVYR-----------------------------------------------
3442|hp|nph         SADSD-RTVLAYR-----------------------------------------------
13610|hp|hbo        NDEPSGRRILAYR-----------------------------------------------
413|chp|hut         SEEAT-RLVLVYR-----------------------------------------------
1675|hp|hhi         NETDD-KLILAYR-----------------------------------------------
2999|hp|hwa         NNEPGGKRILVFR-----------------------------------------------
1478|hp|hla         NEEPSGRAILVYR-----------------------------------------------
                             :.:.                                               

10650|gene|hma      AVPIFSGFGVDATATRIADAECSVLFTGDGFYRRGSGVHLKESADEAIKQAGEELGTTPV
1403|hp|nrc1        ------------------------------------------------------------
3442|hp|nph         ------------------------------------------------------------
13610|hp|hbo        ------------------------------------------------------------
413|chp|hut         ------------------------------------------------------------
1675|hp|hhi         ------------------------------------------------------------
2999|hp|hwa         ------------------------------------------------------------
1478|hp|hla         ------------------------------------------------------------
                                                                                

10650|gene|hma      EHTVVYDRLGIADDPDETIRWTRRDEWWDEAIATADDEYAAKELPSNQESMLLYSSGTTG
1403|hp|nrc1        --------------PD---------------VFDS-ESYPAPCMP---------------
3442|hp|nph         --------------PD---------------VFDG-DEFPPPCLP---------------
13610|hp|hbo        --------------PD---------------VFNE-SDFPAECMP---------------
413|chp|hut         --------------PD---------------IFDT-ETFPAPCLP---------------
1675|hp|hhi         --------------PD---------------IFDS-EQFPAPCLP---------------
2999|hp|hwa         --------------PD---------------IFSERNDLPAMCLP---------------
1478|hp|hla         --------------PD---------------VFGG-DDLPSECLP---------------
                                  **               :    .  ..  :*               

10650|gene|hma      KPKGIVHTHAGALMQAAKEIYFGFDHKPSDRFFWVSDIGWMMGPWTLLGNHAFGGTVFMY
1403|hp|nrc1        -------------------------------------------------------TLKLL
3442|hp|nph         -------------------------------------------------------TVYIT
13610|hp|hbo        -------------------------------------------------------TIFVW
413|chp|hut         -------------------------------------------------------TLYVT
1675|hp|hhi         -------------------------------------------------------TIYLT
2999|hp|hwa         -------------------------------------------------------TIHVT
1478|hp|hla         -------------------------------------------------------TIYLT
                                                                           *: : 

10650|gene|hma      EGAPDHPEPDRFWEMIDRHDITTFGVSPTAIRALRKKG--DEWLEGHDLSSLRLLGST-G
1403|hp|nrc1        QRPPT-----------------------------QRKR--RS-------------GTD-T
3442|hp|nph         RGRPN-----------------------------RRPEGNRN-------------LPP-D
13610|hp|hbo        NGSRA-----------------------------NRPG--AS-------------RIR-T
413|chp|hut         KGTRD-----------------------------RRPG--RP-------------DPDVD
1675|hp|hhi         RGKRT-----------------------------RRPG--AD-------------RT--G
2999|hp|hwa         NGSQA-----------------------------SRPG--AS-------------QIQ-T
1478|hp|hla         NGARN-----------------------------ARPG--SG-------------QYA-T
                                                       .                        

10650|gene|hma      EPWDPESWQWFYEHVGDEDCPIINISGGTEIMGCFLMPMPTQSLKPCTLGGPGLGMDIDI
1403|hp|nrc1        DGW----WVSLL------------------------------------------------
3442|hp|nph         APW----MVTLY------------------------------------------------
13610|hp|hbo        ETW----RAILR------------------------------------------------
413|chp|hut         DPW----HVTLY------------------------------------------------
1675|hp|hhi         ESW----YVTFY------------------------------------------------
2999|hp|hwa         DTW----HVILT------------------------------------------------
1478|hp|hla         EEW----HVVLF------------------------------------------------
                      *       :                                                 

10650|gene|hma      VDSDGE-SIADTHERGYLVARDSCPSMTRSLWSGDDRYLHEYWSTWDDVWDHGDWAQKDE
1403|hp|nrc1        LEPGVRVKHADTHAASRTAAVETVLELAAEFAAGEIDYRSAYQQ----------------
3442|hp|nph         LEPEVN-RDAEAY-DTAAEAAAAAARLTRRFADGDVDYRGLYQI----------------
13610|hp|hbo        LEPDVE-CVIEEY-DSREAAVDGANELARRFADGEIAYRECYQV----------------
413|chp|hut         LEPEVE-GENDAF-DDRDEALSGALELARAFDAGELDYRSWYQV----------------
1675|hp|hhi         LEPDVE-RDADSY-ERRDAAVEGAVDLATRFADGELDYRSLYQV----------------
2999|hp|hwa         LEPEIE-AITKSY-ETRQTALTSAHDIAERFTQGKIEYRDPYQV----------------
1478|hp|hla         LEPEIE-AIAETY-ESPEAGAAAAVDVAERFVAGDVDYRAAYQV----------------
                    ::.       . .      .      ::  :  *.  *   *.                 

10650|gene|hma      DGLWFLHGRADDVLNVAGRKVGPAEVEGAAMEHDAVNQAAAVGVPDDTTGTAVVLYAVLE
1403|hp|nrc1        ------------------------------------------------------------
3442|hp|nph         ------------------------------------------------------------
13610|hp|hbo        ------------------------------------------------------------
413|chp|hut         ------------------------------------------------------------
1675|hp|hhi         ------------------------------------------------------------
2999|hp|hwa         ------------------------------------------------------------
1478|hp|hla         ------------------------------------------------------------
                                                                                

10650|gene|hma      PGYESNDDLRDDIRAAVGEELGKPFRPREVLFVDEFPKTQSGKIIRRAIAGVYRGEDLGD
1403|hp|nrc1        --------------------------PREAYL----------------------------
3442|hp|nph         --------------------------PRESYF----------------------------
13610|hp|hbo        --------------------------PPEAYL----------------------------
413|chp|hut         --------------------------PRAAYL----------------------------
1675|hp|hhi         --------------------------PREAYL----------------------------
2999|hp|hwa         --------------------------PRPDYF----------------------------
1478|hp|hla         --------------------------PREEYF----------------------------
                                              *    :                            

10650|gene|hma      MSSIENPTALDEVREAS-----
1403|hp|nrc1        -------ARLDELTGRDV----
3442|hp|nph         -------ERLDELTGGPTAE--
13610|hp|hbo        -------DRLDELTGRDE----
413|chp|hut         -------DRLDELTGRGT----
1675|hp|hhi         -------DKLDELTGRS-----
2999|hp|hwa         -------QMLDDVIEEIETVPN
1478|hp|hla         -------ERLDEYVGEE-----
                             **: