HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0745COG0080KOG3257 KOG0886arCOG04372Ribosomal protein L1150S ribosomal protein L11P

HOG Organism Gene ID Name Annotation
cHOG0745 nrc1 VNG1108 rpl11p 50S ribosomal protein L11P
cHOG0745 hmu HMUK2187 Hmuk_2187 ribosomal protein L11
cHOG0745 hma RRNAC1414 rpl11p 50S ribosomal protein L11P
cHOG0745 hwa HQ2922A rpl11p 50S ribosomal protein L11P
cHOG0745 hla HLAC1983 Hlac_1983 ribosomal protein L11
cHOG0745 hbo HBOR12260 Hbor_12260 LSU ribosomal protein L11P
cHOG0745 hut HUTA0252 Huta_0252 ribosomal protein L11
cHOG0745 hvo HVO_2758 HVO_2758 ribosomal protein L11
cHOG0745 nph NP4454A rpl11p 50S ribosomal protein L11P
cHOG0745 hhi 1997 rplK 50S ribosomal protein L11P
MUSCLE (3.6) multiple sequence alignment


252|gene|hut        MAGTIEVLVAGGQVDPGPPLGPELGPTPVDVQAVVGEINDQTEAFDGTEVPVTVEYDDDG
1108|gene|nrc1      MAETIEVLVAGGQADPGPPLGPELGPTPVDVQAVVQEINDQTEAFDGTEVPVTIEYEDDG
4454|gene|nph       MAGTIEVLVAGGQADPGPPLGPELGPTPVDVQAVVNEINDQTEAFDGTEVPVTIDYDDDG
2922|gene|hwa       MAGTIEVLIPGGEANPGPPLGPELGPTPVDVQDVVQTINDETDAFDGMEVPVTVEYEDTG
12260|gene|hbo      MAGTIEVLVPGGEANPGPPLGPELGPTPVNVQDVVQEINDETAAFDGMEVPVTVEYDDDG
11414|gene|hma      MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDG
1997|gene|hhi       MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVEYDDDG
1983|gene|hla       MAGTIEALVPGGQATPGPPLGPELGPTPVDVQDVVAQINDETAAFDGMEVPVTVEYDDDG
2758|gene|hvo       MAGTIEVLVPGGKANPGPPLGPELGPTPVDVQDVVNDINDQTAAFDGMEVPVTVEYDDDG
                    ** ***.*:.**:. **************:** **  ***:* **** *****:.*:* *

252|gene|hut        AFTIDVGVPPTAALIKDEAGFETGSGEPQENFVADLSMEQVKTIAEQKHPDLLSYELKQA
1108|gene|nrc1      SFSIEVGVPPTAALVKDEAGFDTGSGEPQENFVADLSIEQLKTIAEQKKPDLLAYDARNA
4454|gene|nph       SFDIDVGVPPTAALIKDELDFETGSGEPNEEFVADMSAEQLKTVAEQKLPDLLAYDTRNA
2922|gene|hwa       DFSISVGVPPTAELIKDEAGFESGSGEPQENFVANMSVDQVQKIAEQKSSDLLSYDTFNA
12260|gene|hbo      SFSIEVGVPPTAELIKDEAGFETGSGEPQENFVADLSFDQVKKIAEQKSSDLLSYDTKNA
11414|gene|hma      SFEIEVGVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNA
1997|gene|hhi       SFEIEVGVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLKNA
1983|gene|hla       SFTIEVGVPPTAELIKDEAGFETGSGEPQVDFVADMSIEQVKKVAEQKSTDLLAYDVKNA
2758|gene|hvo       SFSIEVGVPPTAALIKDEVGFDTGSGEPQENFVADMSIEQLKKVAEQKSSDLLSYDLKNA
                     * *.******* *:*** .*::*****: :***::* :*:: :**** .***:*:  :*

252|gene|hut        AKEIIGTCVTLGVTIEGDDPRKVAAKIDDGEYDEILVDAAEA-
1108|gene|nrc1      AKEVAGTCASLGVTIEGEDARTFNERVDDGDYDDVLGDELAAA
4454|gene|nph       AKEVAGTCVSLGVTIEGEDARTFNQRLDNGEFDDVFAEAEPAA
2922|gene|hwa       AKEVVGTCTSLGVTIDGNNPREFKSRMEDGEYDDILK------
12260|gene|hbo      AKEVVGTCTSLGVTIEGNDPREFKERIDDGEYDDQLVA-----
11414|gene|hma      AKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEAQA-
1997|gene|hhi       AKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEAQA-
1983|gene|hla       AKEVGGTCASLGVTIEGEDARTFDDRVDAGDYDDVLDE-----
2758|gene|hvo       SKEVAGTCASLGVTIEGEDARTFKQRIDGGDFDDYFDDE----
                    :**: ***.:*****:*::.* .  .:: *::*: :