HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0744arCOG04667hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0744 nrc1 VNG1777 vng1777 no entry
tucHOG0744 hmu HMUK1551 Hmuk_1551 conserved hypothetical protein
tucHOG0744 hma RRNAC1713 hypothetical protein
tucHOG0744 hwa HQ3333A hypothetical protein
tucHOG0744 hla HLAC2001 Hlac_2001 hypothetical protein
tucHOG0744 hbo HBOR07300 Hbor_07300 hypothetical protein
tucHOG0744 hut HUTA2826 Huta_2826 conserved hypothetical protein
tucHOG0744 hvo HVO_2314 HVO_2314 conserved hypothetical protein
tucHOG0744 nph NP4554A hypothetical protein
tucHOG0744 hhi 2247 HAH_2247 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1777|hp|nrc1      --MSETANADLYRDTVALLQPGDVTLAGAVIHTTYDNDEESKLHQLTLDAGQVVADHVAD
3333|hp|hwa       --MTDSVDKDLYQRTMALIEPGDIDLVGTVVHTDLTGEEDLEMQELTVSINECLASHIGK
2001|hp|hla       --MSETVDADLYTRTKALLEPGDIELAGCIVHTTLGGQEDLEMHELTVAINEVIADHAGK
7300|hp|hbo       --MSETVDDDLYKRTLALLEPGDIELVGAIIHTDLSGQEDLEMHELTVEINEVIADHAEK
2826|chp|hut      ---MDAMGDDLSEQTKALLEPGEIELRGLIVRTDVANDQEPELNRLTIEIGDVIAEHAET
4554|hp|nph       --MDSAVEDDLYKRTKALLEPGDIELNGVIVDTDLTNDEEPTLHQATLDVGNVIAAAAGI
11713|hp|hma      MSEADALDDDLYRRTKQLLEPGEIQLNGAVVHTEYDGSDEIEMMQATIEVGEFIAEGAGL
2247|hp|hhi       MSEADALDDDLYRRTKQLLEPGEIQLNGAVVHTEYDGSDEIEMMQATIEVGELIAEGASL
                      .:   **   *  *::**:: * * :: *   ..::  :   *:  .: :*     

1777|hp|nrc1      G--DTYVYSGNDDSDFGVNQHQGRILDDDAFVWECQQLLRDGAFAVVLYWEATDDHAAIL
3333|hp|hwa       G--ETYIYAGNDSSEFASNQFQGLTIDDESFVWECQQLLRKGTFDLVFYYEAGPTQAAIA
2001|hp|hla       G--ESYIEAGNDDTNFSSNQFQGLTLDDEAFVWECQQLLRDGTFDLVFYYEANVDQEALA
7300|hp|hbo       G--ETYIYAGNDTPDFASNQFQGLTLDDDAFVWECQQLLRNGTFDLVFYYEANVDQDALT
2826|chp|hut      D-ADTYVYSGTDDPEFGLNQHQGRTIEGEEFVWECQQLMRDGTFDVVFYYEDTADTDAIL
4554|hp|nph       EPTDTYVYSGNDDEEFGINQHQGLTLDGDEFVWECQQLLREGTYKVVFYYEASADQTAIV
11713|hp|hma      DPTDTFVYSGSDDPEFASNQHQGLTLDDEEFVWECQQLLRNGSFDLVFYYEASADHDGIL
2247|hp|hhi       DPKDTYVYSGSDDPEFASNQHQGLTLDGEEFVWECQQLLRNGSFDLVFYYEASADHDGIL
                     :::: :*.*  :*. **.**  ::.: ********:*.*:: :*:*:*      .: 

1777|hp|nrc1      DGIRDCDGVTSVVAVTEDGFEA
3333|hp|hwa       DDLESIEHIKNVTTVP------
2001|hp|hla       DDLAELDNVDRVTQVP------
7300|hp|hbo       ADLEAVEHIDRVRPVP------
2826|chp|hut      ADLRAKGYDVEDVESP------
4554|hp|nph       EGVEGLGFEATSVRGE------
11713|hp|hma      EAVENAGYAVTGVEGE------
2247|hp|hhi       EAIEDAGYAVTGVEGE------
                    :