HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0743COG2167KOG0002arCOG04177Ribosomal protein L39E50S ribosomal proteins L39E

HOG Organism Gene ID Name Annotation
cHOG0743 nrc1 VNG2469 rpl39e 50S ribosomal proteins L39E
cHOG0743 hmu HMUK1234 Hmuk_1234 Ribosomal protein L39e
cHOG0743 hma RRNAC3112 rpl39e 50S ribosomal protein L39e
cHOG0743 hwa HQ3424A rpl39e 50S ribosomal protein L39e
cHOG0743 hla HLAC0828 Hlac_828 Ribosomal protein L39e
cHOG0743 hbo HBOR01080 Hbor_01080 LSU ribosomal protein L39E
cHOG0743 hut HUTA1000 Huta_1000 Ribosomal protein L39e
cHOG0743 hvo HVO_0115 HVO_0115 Ribosomal L39 protein
cHOG0743 nph NP1012A rpl39e 50S ribosomal protein L39e
cHOG0743 hhi 379 rpl39e 50S ribosomal protein L39e
MUSCLE (3.6) multiple sequence alignment


13112|gene|hma      MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE
379|gene|hhi        MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE
828|gene|hla        MGDKSKAQKKRLAKAERQNTRVPAWVMMKTDMNVTRNPKRRNWRRNDLDE
1000|gene|hut       MGKKSKGKKQRLAKLERQNSRVPAWVVMKTDQDVQRNPKRRHWRRNDTDE
2469|gene|nrc1      MGKKSKASKKRLAKLERQNSRVPAWVMMKTNRDVQRNPKRRNWRRNDTDE
1012|gene|nph       MGKKSKAKKKRLSKLERQNSRVPAWVIMKTDRDTMRNPKRRNWRRSDTDE
3424|gene|hwa       MGKKSKAKKKRLGKLEKQNSRVPAWVMLKTNMEVTRNPKRRNWRRSDTDE
1080|gene|hbo       MSKKSKAKKKRLAKLERQNSRVPAWVMMKTDMEVTRNPKRRNWRRSDTDE
                    *..***. *:**.* :.**:******::**: :. ** ***:***.* **