HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0742COG2450 COG3342arCOG02263hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0742 nrc1 VNG2644 vng2644 no entry
cHOG0742 hmu HMUK0618 Hmuk_0618 Protein of unknown function DUF1621
cHOG0742 hma RRNAC2085 hypothetical protein
cHOG0742 hwa HQ3071A hypothetical protein
cHOG0742 hla HLAC0118 Hlac_118 Protein of unknown function DUF1621
cHOG0742 hbo HBOR28000 Hbor_28000 uncharacterized conserved protein
cHOG0742 hut HUTA0144 Huta_0144 Protein of unknown function DUF1621
cHOG0742 hvo HVO_0392 HVO_0392 conserved protein
cHOG0742 nph NP0342A hypothetical protein
cHOG0742 hhi 2578 HAH_2578 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


342|hp|nph         ------------------------------------------------------MGLMSK
12085|hp|hma       MEGRRICVDSCPITCITFCAAHTALGPHHGRSGCAVVIRSMDEKLKRVAHAVSDMGLMSK
2578|hp|hhi        ------------------------------------------------------MGLMSK
144|hp|hut         ------------------------------------------------------MGLMSK
2644|chp|nrc1      ------------------------------------------------------MGFMNK
3071|hp|hwa        ------------------------------------------------------MGIMNK
118|gene|hla       ------------------------------------------------------MGIMSK
28000|hp|hbo       ------------------------------------------------------MGIMSK
                                                                         **:*.*

342|hp|nph         LLG--GNSHSAEDYVELDVDDFDASEAGAASVQVRFTDISEKNDVIDIKDAVYDGDIVIA
12085|hp|hma       ILGESGSSRNTEDYVELNANEFEMT-GTELERQVRIARISDKQDVIDIKDAVYDGDVVVA
2578|hp|hhi        ILGESGSSRNTEDYVELNANEFEMT-GTELERQVRIARISDKQDVIDIKDAVYDGDVVVA
144|hp|hut         ILGGSGASRRTDDYVELDAGDASTT-APEADTEVRIARIGDKQDVIEIKDAVYDGDIVLA
2644|chp|nrc1      ILR--GNGSSTEDYVELDADDFNAD-AGEASVAVHIAEIDGQEDVIAIKDAVYDGDLVVA
3071|hp|hwa        IIG--GETDTPNEYVELDLDDFETV-RGDADVRVRFAKIGGQQDIIDIKDAVYDGDLVIA
118|gene|hla       ILGG-GGNRSVDDYVELDLDDFAEA-HAETGMQVHIAEIGDQGDVIPIKDAVYDGDFVIA
28000|hp|hbo       ILSG-GDNHTTEDYVELDLDDFDTA-RGEAGMSVRIATIGDKQDVVSIKDAVYDGDLVIA
                   ::   *     ::****: .:            *.:: *. : *:: *********.*:*

342|hp|nph         DIIRHTTSDRTMEHILDELKQVANEVGGDIVQKEDDQLIITPAGVGISRSKIGR-
12085|hp|hma       DITRHSTQDRTMEHISDELKQVANEVGGDIVQKDDDQLIITPAGVGIARERLGR-
2578|hp|hhi        DITRHSTQDRTMEHISDELKQVANEVGGDIVQKDDDQLIITPAGVGISRERLGQ-
144|hp|hut         DITRHTTKDRTMEHITDELKQVAGEVGGDIVQKDDDQLIITPSGVAVNRDRLGR-
2644|chp|nrc1      DITRLRTEDRTVEHVIDELRQVAREVGGDIVQKGDDQLIVTPNGIGISREKLNRP
3071|hp|hwa        DITRHTTSDNTMERIVDDLRRVIEEVDGDMVQKGDDQLIIAPTGVAIARQKI---
118|gene|hla       DITRHSTSDRTIEHIIDELRQVAREVDGDIVQKGDDQIIVTPTGVSISREKL---
28000|hp|hbo       DITRHTTSDSTMEHIVDDLRQVAEEVDGDIVQKGDDQIIITPTGVAVSREKLS--
                   ** *  *.* *:*.: *:*..*  **.**:*** ***:*::* *:.: *..: