HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0741COG1761KOG4392 KOG3438arCOG04111DNA-directed RNA polymerase subunit LDNA-directed RNA polymerase subunit L

HOG Organism Gene ID Name Annotation
cHOG0741 nrc1 VNG0860 rpoL DNA-directed RNA polymerase subunit L
cHOG0741 hmu HMUK1961 Hmuk_1961 RNA polymerase dimerisation( EC:2.7.7.6 )
cHOG0741 hma RRNAC1396 rpoL DNA-directed RNA polymerase subunit L
cHOG0741 hwa HQ1696A rpoL DNA-directed RNA polymerase subunit L
cHOG0741 hla HLAC0620 Hlac_620 RNA polymerase dimerisation
cHOG0741 hbo HBOR22240 Hbor_22240 DNA-directed RNA polymerase, subunit L( EC:2.7.7.6 )
cHOG0741 hut HUTA0627 Huta_0627 RNA polymerase dimerisation
cHOG0741 hvo HVO_1042 HVO_1042 RNA polymerase Rpb3/Rpb11 dimerisation domain
cHOG0741 nph NP4162A rpoL DNA-directed RNA polymerase subunit L
cHOG0741 hhi 1971 rpoL DNA-directed RNA polymerase subunit L
MUSCLE (3.6) multiple sequence alignment


860|gene|nrc1       MDLRVIEKDDAELTIEVAGENHTFMNVLKGTLLETDGVTAASYDMNPEQSGGQTEPLLTI
620|gene|hla        MELRVIEKTDTELRIEIAGEDHTFMNVLKGVLLETDDVAAATYDMNPEQSGGQTEPVLTV
4162|gene|nph       MDLRVIENLETELAIEIEGEDHTFMNVLKGALLELDGVTAATYDVNPEQSGGQTEPIVTI
627|gene|hut        MELQVIEKDDTSLSIEISGEDHTFMNVLKGALLETDGVDAATYDMNPEQSGGQTDPILTI
11396|gene|hma      MDLRVIDKSDTELSIEIAGEDHTFMNVIKGALLETEGVTAATYDVNPEQSGGQTDPVLTI
1971|gene|hhi       MDLRVIDKSDTELSIEIAGEDHTFMNVIKGALLETAGVTAATYDVNPEQSGGQTDPVLTI
22240|gene|hbo      MELRVIDKTDEELRLEIAGEDHTFMNVIKGALLETPGVAAATYDVNPEQSGGQTDPILSV
1696|gene|hwa       MELRVIERTDTELRIEVAGEDHTFMNVIKGALLQTDGVAAATYDVNPEQSGGQTEPVLSI
                    *:*.**:. : .* :*: **:******:**.**:  .* **:**:*********:*::::

860|gene|nrc1       KTD--GDVDPVDALQAAAGHTSQKLQSFADTFEAAV-
620|gene|hla        KSE--SG-DPLDVLAEGAESITDRTGALRDAVKAA--
4162|gene|nph       KTD--GSIDPLDALEQGASRVRDKTDAFEEAFEAAA-
627|gene|hut        KTE--SGTDALDALEAGAQYVIEKADTFEAAYEDAAA
11396|gene|hma      KTE--EGVDALEALEDGTDAVIEKADNFTDAFEAAA-
1971|gene|hhi       KTE--EGVDALEALEDGTDAVIEKADNFTDAFEAAA-
22240|gene|hbo      KTE--SGTDPLDALADASQRVQDLSSDFTSAFEAAL-
1696|gene|hwa       QTEPDADVDPLDALGDASRQVQTTVDDFTSAFTAAV-
                    :::   . *.::.*  .:         :  :   *