HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0740COG0186KOG1740 KOG1728arCOG04096Ribosomal protein S1730S ribosomal protein S17P

HOG Organism Gene ID Name Annotation
cHOG0740 nrc1 VNG1700 rps17p 30S ribosomal protein S17P
cHOG0740 hmu HMUK1837 Hmuk_1837 ribosomal protein S17
cHOG0740 hma RRNAC1603 rps17p 30S ribosomal protein S17P
cHOG0740 hwa HQ2833A rps17p 30S ribosomal protein S17P
cHOG0740 hla HLAC2440 Hlac_2440 ribosomal protein S17
cHOG0740 hbo HBOR10320 Hbor_10320 SSU ribosomal protein S17P
cHOG0740 hut HUTA2301 Huta_2301 ribosomal protein S17
cHOG0740 hvo HVO_2555 HVO_2555 RpsQ 30S ribosomal protein S17
cHOG0740 nph NP4872A rps17p 30S ribosomal protein S17P
cHOG0740 hhi 2145 rpsQ 30S ribosomal protein S17P
MUSCLE (3.6) multiple sequence alignment


2440|gene|hla       MAIGIDVPTPPEPDNPEDYDYEKCPFYGQLSVRGQTREGTVVSTDMEKTVIVEREYDVFV
4872|gene|nph       MAIGLDVTQPPEPENPEEYDYETCPFYGELPVRGQVIEGTVVSTDMERTVIVEREYDVNV
2301|gene|hut       MALGLNVQQPDVTCDDEN-----CPFHGTLSVRGQTLEGTVASTDMQKTVVVEREYDVTV
2833|gene|hwa       MAIGLNVTEPEVSCADTN-----CPFHGSLSVRGQTLEGTVASTDMDKTVIVEREYDVRV
10320|gene|hbo      MAIGLNVEEPEEACSDEN-----CPFHGSLAVRGQTIEGTVASTDMDKTVVVEREYDVRV
1700|gene|nrc1      MAIGLNVTEPEGTCSDED-----CPFHGNLSVRGQVLEGEVASTDMEKTVVVEREYDVFV
11603|gene|hma      MALGLNVQEPEETCADQN-----CPFHGELSVRGQTLNGEVASTDMEKTVVVEREYDVKV
2145|gene|hhi       MALGLNVQEPEETCADQN-----CPFHGELSVRGQTLNGEVASTDMEKTVVVEREYDVKV
                    **:*::*  *  .    :     ***:* *.****. :* *.****:.**:******* *

2440|gene|hla       PKYDRYMKRRSRIPAHVPGVLDSLEVGDEVKIAETRPLSKTKSHVVVE-------NL--S
4872|gene|nph       PKYDRLMKRRSRIPAHVPEVLEPLSVDDEVKIAETRPLSKTKSHVVVE-------VT--E
2301|gene|hut       PKYDRLMKRRSRIPAHAPPCMD-VEEGDTVTIAETRPLSKTKSHAVVA-------KH--G
2833|gene|hwa       PKYDRLMKRRSRIPAHAPPCVD-LAEGDTVRIAETRPLSKTKSHVVVE-------QIDTG
10320|gene|hbo      PKYDRYMKRRSRIPAHAPPCMD-LEEGDTVRIAETRPLSKTKAHVVVE-------TL--G
1700|gene|nrc1      PKYDRYMKRRSRVPAHAPECFD-ISVGDTVSIAETRPLSKTKSHVVVE------ITD--G
11603|gene|hma      PKYDRFMKRRSRVPAHAPDCLD-LAVGDTVTIAECRPLSKTKSHVVVG-----VVADEQD
2145|gene|hhi       PKYDRFMKRRSRVPAHAPDCLD-LAVGDTVTIAECRPLSKTKSHVVVSAGSDEAANDEQD
                    ***** ******:***.*  .: :  .* * *** *******:*.**             

2440|gene|hla       GDQ
4872|gene|nph       GDA
2301|gene|hut       GAD
2833|gene|hwa       GAE
10320|gene|hbo      GEE
1700|gene|nrc1      GDA
11603|gene|hma      GDA
2145|gene|hhi       GDA
                    *