HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0074COG0489KOG3022arCOG00585ATPases involved in chromosome partitioningputative chromosome partitioning protein

HOG Organism Gene ID Name Annotation
cHOG0074 nrc1 VNG1131 mrp putative chromosome partitioning protein
cHOG0074 hmu HMUK2587 Hmuk_2587 protein of unknown function DUF59
cHOG0074 hmu HMUK1565 Hmuk_1565 protein of unknown function DUF59
cHOG0074 hma RRNAC0056 mrp1 Mrp protein-like
cHOG0074 hwa HQ2949A mrp ATP-binding protein Mrp
cHOG0074 hla HLAC1831 Hlac_1831 protein of unknown function DUF59
cHOG0074 hbo HBOR12610 Hbor_12610 ATPase involved in chromosome partitioning
cHOG0074 hut HUTA2528 Huta_2528 Cobyrinic acid ac-diamide synthase
cHOG0074 hvo HVO_2790 HVO_2790 mrp Mrp protein homolog
cHOG0074 nph NP2824A mrp_1 ATP-binding protein Mrp 1
cHOG0074 nph NP4940A mrp_2 ATP-binding protein Mrp 2
cHOG0074 hhi 815 mrp1 ATP-binding protein mrp
MUSCLE (3.6) multiple sequence alignment


4940|gene|nph       MTELEDELEARLREIEDPIVGEDILSMQLINDVEI-----DDGT--ASISLAFNTPFAPA
2528|gene|hut       --MDEAELRELLASVEDPDLDDDIVSLGLVNDVEL-----ENGT--AHIDLALGAPFSPT
2824|gene|nph       --MNEETVLDRLAAVEDPDLGDDIVSLGLVNDVNI-----DAET--IHVDLALGAPYSPT
10056|gene|hma      --MNIDDVRERLRMVEDPDLGDDIVSLGLINSIDV-----TDDE--VSIDLALGAPYSPT
815|gene|hhi        --MNTDDVRERLRTVEDPDLGADIVSLGLINSIDV-----TDDE--VSIDLALGAPYSPT
1131|gene|nrc1      --MNDDDVMELLASVTDPALGDDIVSLGLVNDLSV-----DDGT--VTISLALGAPYSPA
1831|gene|hla       --MNEADVRERLVDVRDPDLGDDIVSLGLVNDVEV-----DDDE--IRISLALGAPFSPH
2949|gene|hwa       --MHTATVRDRLRDVTDPDLEDDIVSLGLVNAIDI-----DESNNTIRISLALGAPYSPA
12610|gene|hbo      --MNDEAVRDRLRAVEDPDLGDDIVSAGLVNAIEVASDDADDGSGVVRISLALGAPYSPH
                           :   *  : ** :  **:*  *:* :.:             :.**:.:*::* 

4940|gene|nph       ELELGDEIRAAVSDV--GLEPDLYAEVGREHGFDEEVMPNVRNVVAVASGKGGVGKTTVA
2528|gene|hut       ETTIADRVREVIGDAAPDLAVELSATIDRG--TEGDILPGVKNVIAVASGKGGVGKSTTS
2824|gene|nph       ETELAGTVRDALSEL--DREIDLTASVDTGLSADEQILPDVENIIAVASGKGGVGKSTVA
10056|gene|hma      ETGIANEVREALGDL--DREIDLSASVDRGVPEAEDPLPKVKNVIAVASGKGGVGKSTVA
815|gene|hhi        ETSIANEVREAMGDI--DREIDLSASVDRGVPEAEDPLPKVKNVIAVASGKGGVGKSTVA
1131|gene|nrc1      ETEIAAHVRETLEAE--GLETDLTAAIPDR--SETEVLPGVKNVVAVASGKGGVGKSTVA
1831|gene|hla       ESAIADDVRAALADT--GLDVELSASIPDDLEPDEQVLPGVKNVIAVASGKGGVGKSTMA
2949|gene|hwa       ESKIAAQVREVLADL--EYDLDLAATIPS-VESEDEVLPGVTNVIAVASGKGGVGKSTVA
12610|gene|hbo      ETDIAAQVREQFSDT--DYEVDLTAKIPSDLSADEDVLPGVKNIIAVASGKGGVGKSTVA
                    *  :.  :*  .         :* * :        : :* * *::***********:* :

4940|gene|nph       ANLAAGLDELGARVGLLDADIHGPNAPRVLPVEEQPGVTPDEKIVPPTADGVKVMSMGFL
2528|gene|hut       VNLAAGLADRGARVGLFDADIYGPNVPRMLDAHERPEATDDDKIIPPEKHGMKLMSMDFL
2824|gene|nph       VNLAAGLSQLGARVGLFDADVYGPNVPRMVEADDQPKATEQETIIPPEKYGMKLMSMDFL
10056|gene|hma      VNLAAGLSRLGARVGLFDADVYGPNVPRMLDADEQPQATEDEEIIPVEKHGMRLMSMDFL
815|gene|hhi        VNLAAGLSRLGARVGLFDADVYGPNVPRMLDADESPRATEDEEIIPVEKHGMKLMSMDFL
1131|gene|nrc1      VNLAAALSDRGARVGLFDADIYGPNVPRMVDADDHPQATETETIVPPEKHGMKLMSMAFM
1831|gene|hla       VNIAAGLSALGARVGLFDADVYGPNVPRMVSAEERPQ-TDGETIVPPERFGVKLMSMDFL
2949|gene|hwa       VNLATGLSDLGARVGLFDADIYGPNVPRMVDAGEAPETEDEQTIVPPEKYGMKLMSMAFL
12610|gene|hbo      VNLAAGLSKLGARVGLFDADIYGPNVPRMVAADEAPQATGDQTIVPPEKYGMKLMSMAFL
                    .*:*:.*   ******:***::***.**:: . : *     : *:*    *:.:*** *:

4940|gene|nph       LEEEDDPAILRGPMVNNVMTHFFENVEWGALDYLVVDLPPGTGDASLDLVQTLPVAGVVI
2528|gene|hut       L-GEDDPVIWRGPMVHQTLTQLFEDVQWGELDYLVVDLPPGTGDTQLTLLQTVPVTGAVI
2824|gene|nph       V-GEDDPVIWRGPMVHKVLTQLWEDVEWGALDYMVVDLPPGTGDTQLTLLQSVPVSGAVI
10056|gene|hma      V-GKDDPVIFRGPMVDNVLTQLWDDVLWGELDYMVVDLPPGTGDTQLTMLQQVPVSGAVI
815|gene|hhi        V-GKDDPVIFRGPMVDNVLTQLWDDVLWGELDYMVVDLPPGTGDTQLTMLQQVPVSGAVI
1131|gene|nrc1      V-GEDDPVIWRGPMVHKVLTQLIEDVEWGYLDYLVVDLPPGTGDTQLTLLQTLPLTGSVV
1831|gene|hla       T-GEDDPVIWRGPMVHKIITQLVEDVEWGELDYLVMDLPPGTGDTQLTILQTLPLTGAVI
2949|gene|hwa       V-GEDDPVIWRGPMVHQILTQLVEDVRWGDLDYLVLDLPPGTGDTQLTILQTLPLTGAVV
12610|gene|hbo      V-GEDDPVIWRGPMVHQLLTQLVEDVQWGELDYMILDLPPGTGDTQLTVLQTLPLTGAVI
                       :***.* ***** : :*:: ::* ** ***:::********:.* ::* :*::* *:

4940|gene|nph       VTTPQEMAVDDARKGLRLFEKHETPVLGIVENMSRYHCPSCGDEHDPFGRGGAEEMVESY
2528|gene|hut       VTTPQGVALDDAKKGLEMFGKHDTPVLGIVENMSSFKCPDCGSEHAIFGEGGGREFAEQV
2824|gene|nph       VTTPQKVALDDAEKGLQMFGEHDTPVLGIVENMSGFVCPDCGSEHDIFGSGGGESFADDV
10056|gene|hma      VTTPEEVALDDARKGLRMFGRHETPVLGIVENMSSFVCPDCGGTHDIFGSGGGREFADET
815|gene|hhi        VTTPEEVALDDARKGLRMFGRHETPVLGIVENMSSFVCPDCGGTHDIFGSGGGREFADET
1131|gene|nrc1      VTTPEDVAVDDARKGLRMFGRHDTTVLGVVENMSSFVCPDCGGTHDIFGAGGGEEFATAN
1831|gene|hla       VTTPQEVALDDAVKGLRMFGKHDTNVLGIAENMAGFRCPDCGGFHEIFGSGGGKALAQEH
2949|gene|hwa       VTTPQDVAVDDARKGLRMFGEHDTNVLGIVENMASFTCPDCESIHDIFGEGGGQVFAANN
12610|gene|hbo      VTTPQDVAIDDARKGLQMFGKHDTNVLGIVENMSSFRCPDCGSSHDIFGAGGGEAFAAEN
                    ****: :*:*** *** :*  *:* ***:.***: : **.* . *  ** **.  :.   

4940|gene|nph       DVELLGQLPIHEDFGADGSE-LPAVKLDASPVQDAAQSVMTDIADRLGEVNRLKVADMLE
2528|gene|hut       QMPFLGEIPLDPEIRERGDEGRPAVLADDLDVSDAFRNFVANTANNQGIVHRNRVAEQSE
2824|gene|nph       EMPFLGRIPLDPAVREGGDAGRPVVLDEDDETGEALRSFTERTANMQGIVRRRQVSAADR
10056|gene|hma      EMPFLGEIPLDPEVREGGATGEPLVLDEDSDVGESFRDIAARTANMQGIIHRKRQSDSQR
815|gene|hhi        EMPFLGEIPLNPEVREGGATGEPLVLDEDSDVGESFRDIAARTANMQGIIHRKRQSDSQR
1131|gene|nrc1      ELPFLGSIPLDPSVRAGGDNGQPVALDPDNETGASFRTFAAETADMLGLVQRRGVGE---
1831|gene|hla       DLPFLGGVPLDPAVRTGGDDGEPVVL-EEGETADAFRVIVENVANNAGVVRRRGVSEGR-
2949|gene|hwa       DLPFLGSLPLDPQVRTGSDDGDPAVL-GSGGTADAFEAMTANVADMVGVTRRRDVMNR--
12610|gene|hbo      DMPFLGAIPLDPDVRTGGDGGRPVVLEDEGETAEAFRRMTESVADMAGVVRRREVSER--
                    :: :** :*:   .   .    * .      .  :   .    *:  *  .*        

4940|gene|nph       LGREEDKSPVDESPQSQSGPKL
2528|gene|hut       ----------------------
2824|gene|nph       ----------------------
10056|gene|hma      AQPEQ-----------------
815|gene|hhi        AQPEQ-----------------
1131|gene|nrc1      ----------------------
1831|gene|hla       ----------------------
2949|gene|hwa       ----------------------
12610|gene|hbo      ----------------------