HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0738COG1873arCOG02155Uncharacterized conserved proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0738 nrc1 VNG0982 vng982 no entry
cHOG0738 hmu HMUK2388 Hmuk_2388 PRC-barrel domain protein
cHOG0738 hma RRNAC0743 PRC-barrel domain-containing protein
cHOG0738 hwa HQ2582A hypothetical protein
cHOG0738 hla HLAC1399 Hlac_1399 PRC-barrel domain protein
cHOG0738 hbo HBOR15200 Hbor_15200 uncharacterized conserved protein
cHOG0738 hut HUTA0396 Huta_0396 PRC-barrel domain protein
cHOG0738 hvo HVO_1691 HVO_1691 putative PRC-barrel domain
cHOG0738 nph NP3706A hypothetical protein
cHOG0738 hhi 1390 HAH_1390 PRC-barrel domain-containing protein
MUSCLE (3.6) multiple sequence alignment


10743|gene|hma      --MGMENLPQEITALVGREVYSKNGVFVGEVEDLRLEL-DRKEVTGLALHQLNTELFDEE
1390|gene|hhi       --MGMENLPQEITALVGREVYSKNGVFVGEVEDLRLEL-DRKEVTGLALTQLNTELFDEE
396|gene|hut        MSIDRDATPQEITSLVGREVYSSNGVYVGEIEDLRLDL-DAEAVTGLALHQLNTELFDAE
2582|hp|hwa         ----MDETIEEITTLIGHKVYSNSGVFVGEVEDLRVDLKDRREITGLALTQLNDELFSDR
3706|hp|nph         --METESAPQEITSLVGREVYSNNGVFVGEVEDLQLNL-DRESVTGLALGELNRELFAGH
982|chp|nrc1        ----MDADADEITSLVGREVYSNNGVFVGEVEDIQLNL-NAEAVTGLALTELNADLFAAQ
15200|hp|hbo        ----MEGTPEELTTLVGREVYSNNGVFVGEVDDIRLDL-NRQAVTGLALSRLNDELFQSR
1399|gene|hla       ----MNAVPEEITSLVGREVYSNNGVFVGEIEDVRLDL-DAQAVTGLALAELNHELFAGR
                         :   :*:*:*:*.:***..**:***::*:.::* :   :*****  ** :**   

10743|gene|hma      VNASRGVIIPYRWVQAVGDVVIVSDIVERLR-QPEAGDEEEEVPA
1390|gene|hhi       VNTARGVIIPYRWVQAVGDVVIVSDIVERLR-QPEAGDEEEEVPA
396|gene|hut        TASARGAIVPYRWVQAVGDIVIINDIVERVH-GADADESEEDIVA
2582|hp|hwa         VEPGTGVIVPYRWVRSVGDIVLVTDVVERLK-DDEDDEDGNTVVA
3706|hp|nph         VPSSDGVIVPYRWVRAVGDIILVNDAVEKIQ-EPEEPDAV-----
982|chp|nrc1        MTGQKGVIVPYRWVRAVGDIILINDVVERYE-GDDADSEIAV---
15200|hp|hbo        VEPGKGVLIPYRWVRAVGDVILINDVVERLK-RPDEEEESTLVA-
1399|gene|hla       VDRNTGVIVPYRWVRAVGDVVLINDVIERLDTGTDEPEAEAEAEV
                         *.::*****.:***::::.* :*.     :  .