HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0736COG2443KOG3498arCOG02204Preprotein translocase subunit Sss1protein translocase

HOG Organism Gene ID Name Annotation
cHOG0736 nrc1 VNG0375 secE protein translocase
cHOG0736 hmu HMUK2937 Hmuk_2937 protein translocase SEC61 complex, gamma subunit
cHOG0736 hma RRNAC0700 secE preprotein translocase subunit SecE
cHOG0736 hwa HQ1242A secE preprotein translocase subunit SecE
cHOG0736 hla HLAC0900 Hlac_900 protein translocase SEC61 complex, gamma subunit
cHOG0736 hbo HBOR24990 Hbor_24990 protein translocase subunit secE/sec61 gamma
cHOG0736 hut HUTA0894 Huta_0894 protein translocase SEC61 complex, gamma subunit
cHOG0736 hvo HVO_0718 HVO_0718 Sec61 gamma subunit
cHOG0736 nph NP0812A secE preprotein translocase subunit SecE
cHOG0736 hhi 1349 secE preprotein translocase subunit SecE
MUSCLE (3.6) multiple sequence alignment


375|gene|nrc1       MDVPLELSAYTRVLRLASTPSWEEFSQIAKIAGAGILLIGAIGFLVFLIMGGIVS-VI--
900|gene|hla        MDVPYDLNSYIRVLKLASTPSTDEFLQVSKIAGAGILLIGFIGFLMFAIMSLLPGVGA--
24990|gene|hbo      MDVKYDLNSYVRVLKKASTPSWDEFSQIGLIAGAGIFLIGFMGFVIFALMSFLPG-GV--
1242|gene|hwa       MDVKIELSSYVRVLKLASTPSWNEFSQIGLIAGAGIVFVGFLGFLIFAIMTLLPG-GV--
812|gene|nph        MKTPTDLTSYIRVLKLASTPTWDEFSKVATIAGLGILLVGFIGFVIFSIMTFVPG-GP--
894|gene|hut        MDVPYDITSYVRVLKLASTPSWQEFSQIAKIAGAGILLVGLLGFLIFVIMIPITG-GL--
10700|gene|hma      MDVPYDLTSYIRVLKLASTPSWEEFSQIAKIAGAGIALVGLLGFIIFAVMTFVPG-SKPV
1349|gene|hhi       MDVPYDLTSYIRVLKLASTPSWEEFSQIAKIAGAGIALVGLLGFIIFAVMTFIPG-SKPV
                    *..  ::.:* ***. ****: :** ::. *** ** ::* :**::* :*  : .