HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0734COG2524arCOG00610Predicted transcriptional regulator contains C-terminal CBS domainsinosine-5'-monophosphate dehydrogenase

HOG Organism Gene ID Name Annotation
cHOG0734 nrc1 VNG0890 imd2 inosine-5'-monophosphate dehydrogenase
cHOG0734 hmu HMUK2734 Hmuk_2734 Protein of unknown function DUF293
cHOG0734 hma RRNAC0451 hypothetical protein
cHOG0734 hwa HQ2649A transcriptional regulator
cHOG0734 hla HLAC0936 Hlac_936 Protein of unknown function DUF293
cHOG0734 hbo HBOR16490 Hbor_16490 predicted transcriptional regulator, contains C- terminal CBS domains
cHOG0734 hut HUTA2771 Huta_2771 transcriptional regulator, TrmB
cHOG0734 hvo HVO_1577 HVO_1577 imd inosine-5''-monophosphate dehydrogenase
cHOG0734 nph NP3506A hypothetical protein
cHOG0734 hhi 1448 HAH_1448 putative transcriptional regulator, contains C-terminal CBS domains
cHOG0734 hhi 1184 HAH_1184 transcriptional regulator
MUSCLE (3.6) multiple sequence alignment


1448|gene|hhi      ------------MLTTLVNRYQQTGEAVTGETIAEEIDRNPGTVRNQMQSLTSLGLVEGI
890|gene|nrc1      MSSIELTASQKTVLRALVDRYTQQETAVKGEAIADEVDRNPGTIRNQMQSLKALQLVEGV
3506|hp|nph        MSSIELTPSQKTILQELINLYRESESAVKGEDIAEKVDRNPGTIRNQMQSLKALQLVEGV
10451|hp|hma       MSSIELTPSQKNILQELVNLYRESESAVKGEDIAEKVDRNPGTIRNQMQSLKALQLVEGV
1184|gene|hhi      MSSIELTPSQKNILQELVNLYRESESAVKGEDIAEKVDRNPGTIRNQMQSLKALQLVEGV
2771|gene|hut      MSSIELTPSQKNILQELVNLYRDSESAVKGEEIAERVNRNPGTIRNQMQSLKALQLVEGV
2649|gene|hwa      MSSIELTSSQKSILTALINLHREDEEAVKGETIADEVDRNPGTIRNQMQSLKALQLVEGV
16490|hp|hbo       MSSIELTSSQKTILTALINLYRQTEDAVKGEDIAEEVNRNPGTIRNQMQSLKALQLVEGV
936|gene|hla       MSSIELTSSQKSILTALINLYGEQEDAVKGEAIAEEVDRNPGTIRNQMQSLKALQLVEGV
                               :*  *:: : :   **.** **: ::*****:*******.:* ****:

1448|gene|hhi      PGPTGGYKPTSEAFDAIDRQQIDEAESVVVAHDYERV-DVTVEEINFTNVHDPEKCRARF
890|gene|nrc1      PGPKGGYKPTVDAYEALDIQQLDSAAEVPVTHEGEDITDVNVKKVNLTSVHHPELCRAEV
3506|hp|nph        PGPKGGYKPTATAYDALKIQEMEQAADVPFNHEGDLVEEANVQEIDLTSVHHPELCRAEI
10451|hp|hma       PGPKGGYKPTANAYDALQIQDMDQAAEVPLRHNGELVEHSNVEEIDLTSVHHPEECRAEI
1184|gene|hhi      PGPKGGYKPTANAYDALQIQDMDQAAEVPLRHNGELVEHSNVEEIDLTSVHHPEECRAEI
2771|gene|hut      PGPKGGYKPTATAYDALQIQDMDHAAEVPLFHNGEQIEEANVAEINLASVHHPENCRAEV
2649|gene|hwa      PGPKGGYKPTANAYEALELDQMEDPAFVPLFHENEEINNANVEEIDLSSVHHPELCRAEI
16490|hp|hbo       PGPKGGYKPTANAYEALDVEQMDEPASVPLFHNGEPVEGVNVDEVDLSSVHHPELCRAEI
936|gene|hla       PGPKGGYKPTSNAYEALDIQRMDEPADVPIFHEGEEVTGVNVDGIDLSSVHHPELCRAEI
                   ***.******  *::*:. : :: .  * . *: : :   .*  ::::.** ** *** .

1448|gene|hhi      HLQSSVQDFSEGQAVILGPTPISKLVVAGTVVAVDESNSEILLDVAKIEAPVE--EPEK
890|gene|nrc1      HFRGSIRDIHDGDSVIVGPTPLSKLQVSGTVDGKDDAKGVVILKIDAMEAPAD--EPAH
3506|hp|nph        KLQGSMADFEEGDKISVGPTPLSKLLIEGELEGKDDTNNSLILTIDNMAAPAGDEDPLH
10451|hp|hma       QLQGTMSEFHEGDSVTVGPTPLSKLQIIGTLEGKDDTNNKLILAIDDMRAPAG--EPEH
1184|gene|hhi      QLQGTMSEFHEGDSVTVGPTPLSKLQIIGTLEGKDDTNNKLILAIDDMRAPAG--EPEH
2771|gene|hut      TLQGSLADYDEGDSVTVGPTPLSKLQIVGTLDGKDDTSNKLILTIDDMVAPAE--APEH
2649|gene|hwa      HIQGSVRDFHEGDSMTVGPTPLSKLVIEGTIDGKDDTSNILILQIDDMQAPAS--EPAH
16490|hp|hbo       HVQGSVREFHEGDEVRVGPTPLSKLVVEGIVDGKDDTSNILILRIEDMRAPEG--EPSH
936|gene|hla       HVQGSVRDFHEGDSVTVGPTPLSKLVIDGTVDGKDDTANVLILRIDDMRAPDE--PAEH
                    ...:: :  :*: : :****:*** : * : . *:: . ::* :  : **     . :