HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0733COG1605KOG0795arCOG04601Chorismate mutasehypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0733 nrc1 VNG1244 vng1244 no entry
cHOG0733 hmu HMUK2349 Hmuk_2349 Chorismate mutase( EC:5.4.99.5 )
cHOG0733 hma RRNAC0752 hypothetical protein
cHOG0733 hwa HQ2763A pheA chorismate mutase
cHOG0733 hla HLAC1875 Hlac_1875 Chorismate mutase
cHOG0733 hbo HBOR19090 Hbor_19090 chorismate mutase( EC:5.4.99.5 )
cHOG0733 hut HUTA3024 Huta_3024 Chorismate mutase
cHOG0733 hvo HVO_1322 HVO_1322 pheA chorismate mutase
cHOG0733 nph NP3980A pheA1 chorismate mutase
cHOG0733 hhi 1402 pheA1 chorismate mutase
MUSCLE (3.6) multiple sequence alignment


2763|gene|hwa       MTPDTDANADTDTDADTDTAVNTESKVDGGIVTTESDSLESLRKEIKSIDRELVELIARR
1244|chp|nrc1       ------------------M------------------TLDELRAEIESIDREIVDLIARR
3024|gene|hut       -----MANNDTDRRYPDEM------------------SLDELREEIESIDRELVELIARR
19090|gene|hbo      MTRDTHPTNETTEKRPDEM------------------SLDELRDEIADIDRELVELIARR
1875|gene|hla       ---------MSDTPNSEDR------------------SLDELRREIEDIDREIVELIARR
3980|gene|nph       ------------------M------------------DLDELRKEIQSIDQEIVELIAQR
10752|hp|hma        ---------MSTNSNPEDM------------------SLDELRDEIRTIDREIVEKIAQR
1402|gene|hhi       ---------MSTNPNPEDM------------------SLDELRDEIRTIDQEIVEKIAQR
                                                          *:.** **  **.*:*: **.*

2763|gene|hwa       TYVADSIAQVKSEQGLPTTDEGQEARVMERAGINAEQFDVDANLVKAVFRLLIELNKVEQ
1244|chp|nrc1       TYVAETIADVKAEQGLSTTDESQEDAVMERAGENAAAFGVDDNLVKAVFRLLIELNKIEQ
3024|gene|hut       TYVADTIAAVKADRDLPTTDERQEQRVMDRAGANAEQFDVDANLVKAIFRLLIELNKVEQ
19090|gene|hbo      TYVADTVARVKDERDLPTTDESQEEVVMERAGENAERFDVDSNLVKAIFRLLIELNKVEQ
1875|gene|hla       TYVADTVAAVKEERDLPTTDEGQEEQVMERAGANAERFDVDANLVKAIFRLLIELNKVEQ
3980|gene|nph       TYVAESIAAVKRERGLPTTDESQEEAVMERAGENAEQFDVDANLVKAIFRLLIELNKVEQ
10752|hp|hma        TYVADTIAQVKDEKGLPTTDEQQEQAVMDRAGDNAEQFDVDQNLVKAIFRLLIELNKVEQ
1402|gene|hhi       TYVADTIAQVKDEKGLPTTDEQQEQAVMDRAGDNAEQFDVDENLVKAIFRLLIELNKVEQ
                    ****:::* ** :..*.**** **  **:*** **  *.** *****:*********:**

2763|gene|hwa       RQNR
1244|chp|nrc1       RETR
3024|gene|hut       RENR
19090|gene|hbo      RESR
1875|gene|hla       RESR
3980|gene|nph       RESR
10752|hp|hma        RENR
1402|gene|hhi       RESR
                    *:.*