HOG COG KOG arCOG COG description NRC-1 annotation
nucHOG0732arCOG03114/2hypothetical protein

HOG Organism Gene ID Name Annotation
nucHOG0732 nrc1 VNG0227 vng227 no entry
nucHOG0732 hmu HMUK0026 Hmuk_0026 protein of unknown function DUF192
nucHOG0732 hma RRNAC1691 hypothetical protein
nucHOG0732 hwa HQ1291A hypothetical protein
nucHOG0732 hla HLAC0257 Hlac_257 protein of unknown function DUF192
nucHOG0732 hbo HBOR25650 Hbor_25650 uncharacterized conserved protein
nucHOG0732 hut HUTA2427 Huta_2427 protein of unknown function DUF192
nucHOG0732 hvo HVO_0645 HVO_0645 Uncharacterized ACR COG1430
nucHOG0732 nph NP0628A hypothetical protein
nucHOG0732 hhi 2226 HAH_2226 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1291|hp|hwa       ------------------------------------MYLKHI--SHTDSSVDTLATDIEI
2427|hp|hut       ------------------------------------MRVVHE--PADGDETRTLATDIQM
227|hp|nrc1       ------------------------------------------------------------
628|hp|nph        MSTLIRPQYVSVPERCWSVLADNAGRFLPAGSPHGTVRVVHE----TDGGGRPLATKVDV
11691|hp|hma      --------MRGNECPCPLKSTVPTEDFLPAYDFGGGMRLVHD----PDGAAHPLATEVEY
2226|hp|hhi       ------------------------------------MRLVHD----PDGAARSLATEVEY
25650|hp|hbo      ------------------------------------MYVEHR----QDGTGRTIASDVEV
257|gene|hla      ---------------------------------MPSVRLVHRSGPSDDRESQLLASDVDV
                                                                              

1291|hp|hwa       AATWCTHIRGLMFRRDFSVGSALVFQFDRVTQRTIHMLFVYSDIDVLWLKDNIVKKCTRL
2427|hp|hut       AEGVLAKVRGLRFRRSLPDDYALVFPFGHAGRRDIDMLFVRTSIDVLWISDNRVQQVKTL
227|hp|nrc1       -----------MFRTSIPDDYALVFPFGDPEVRDAHMVCVPFDIDAIWVVDEEVQHVETM
628|hp|nph        ADSLVSQGLGLMFRRSIPDDYALVFPFDEAAPRTLHMVFVPFDIDAIWLEAGDVRAVERL
11691|hp|hma      AESILEQGRGLMFRSSIPDDYALVFPFDHASRQFIHMLFVRFPLDVLWLVDEEVQAVDTL
2226|hp|hhi       AESMLEQGRGLMFRSSIPDDYALVFPFDRASRQFIHMLFVRFPLDVLWLVDEEVQAVETL
25650|hp|hbo      ADTFLTKARGLMFRRRIPDDYALVFEFDEVDKRNLHMVFVPFDIDALWLAGEEVTKKKRL
257|gene|hla      ARSTLEQGRGLMFRRSIPDDYALVFPFDAPDIQWLHMLFVPFAIDALWLVDGEVQKTKRL
                              **  :. . **** *.    .   *: *   :*.:*:    *     :

1291|hp|hwa       SAWYGIGTAEGDTVIELPSGVAGAISTGDTVRIVADD-
2427|hp|hut       RPWIGFGLARADCVIELPPGVADGVEAGDRVLVESEDS
227|hp|nrc1       AAWTGRASADCDTLIELPAGAASGVGVGDRVRVTEESA
628|hp|nph        GGWTGYGRAVADTVIELPAGAADAVSVGDRVRIDGLTG
11691|hp|hma      QPWRSIGYATADTVIELPGGAASDVSEGDTVRLE----
2226|hp|hhi       QPWRSVGYANADTVIELPGGAASDVSEGDTVRLE----
25650|hp|hbo      SGWTGIGFGLADRIIELPAGAADGIERGDTVRLVE---
257|gene|hla      APFVGLGRGRADTVVELPAGAADGVAVGDEVRLVE---
                    : . . .  * ::*** *.*. :  ** * :