HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0731COG0640arCOG02943transcriptional regulator

HOG Organism Gene ID Name Annotation
cHOG0731 nrc1 VNG0511 arlR5 transcriptional regulator
cHOG0731 hmu HMUK2901 Hmuk_2901 transcriptional regulator, ArsR family
cHOG0731 hma RRNAC3327 hypothetical protein
cHOG0731 hwa HQ1541A ArsR family transcriptional regulator
cHOG0731 hla HLAC0184 Hlac_184 ArsR family transcriptional regulator
cHOG0731 hla HLAC3617b Hlac_3617 putative transcriptional regulator, AsnC family
cHOG0731 hla HLAC3645b Hlac_3645 hypothetical protein
cHOG0731 hbo HBOR23680 Hbor_23680 transcriptional regulator, ArsR family
cHOG0731 hut HUTA0369 Huta_0369 transcriptional regulator, ArsR family
cHOG0731 hvo HVO_0852 HVO_0852 conserved hypothetical protein
cHOG0731 nph NP1522A transcription regulator
cHOG0731 hhi 567 arsR3 ArsR family transcriptional regulator
MUSCLE (3.6) multiple sequence alignment


3617|gene|hla       ----MTTQGELQIASFTELRDAIQDLPPSAKLVALILKHEGTLSQREIATKSHLSERTVR
3645|hp|hla         ----MTTQGEPRTESSTELRDAIQDLPPSAKLVAIVLEHNGTLTQRELATESLLPERTVR
369|gene|hut        MSITEPTQVD---TAQDTSWDAVSDLPPSAKLVAKSLEYQGSLTQSQLAEETLLPARTVR
1522|gene|nph       MSATDTKAVE------SDGWEAVAELPPSAKLVAKVLEYNDRLTQSQLAEETMLPPRTVR
511|hp|nrc1         MSATETA-------------DALESLPPSAKLVAKVLEYNDTLSQRELAEKTLLPDRTVR
1541|gene|hwa       MSTTEALAGE---ETSSDRWDPVREMPPSAKLVAKVLDYNEQLTQSQLAEETLLPPRTVR
23680|gene|hbo      MSTTEVVGTD---EGTTDRWDPIREMPPSAKLVAKVLDYNETLTQSQLAEETLLPPRTVR
852|hp|hvo          MSTTEAVERESE-PDADDRWASVRDMPPSAKLVAKILDYEDTLTQSQIAEESLLPPRTVR
184|gene|hla        MSATDAVAAE---EDVTDRWSAVRDLPPSAKLVAKVLDYNDTLTQSELAEETLLPPRTVR
13327|hp|hma        MSASDIQSADADSEDEDSGWDAVRDLPPSAKLVAKVLEYNETLTQSQLAEETLLPPRTVR
567|gene|hhi        MSASDIQSADTDSEHETSGWDAVRDLPPSAKLVAKVLEYNETLTQSQLAEETLLPPRTVR
                                         .: .:********  *.::  *:* ::* :: *. ****

3617|gene|hla       YGLNELQQVDVVESRTSLQDARKRLYTLTVRDSHQ-----DSR--------------
3645|hp|hla         LGLDKLQEVGVVESRTSLQDARKRLYTLSVESTSKTPSSGDKH--------------
369|gene|hut        YALSRLEEVDVVESRFSFSDARKRVYSLTIE--------------------------
1522|gene|nph       YGLNRLEEVDAVDSRFSFTDARKRVYTLAVEDEAKQDGTRGTKRDGTRSGSVLPADD
511|hp|nrc1         YALTRLEDHDIVSSRFSFTDARKRLYTLT----------------------------
1541|gene|hwa       YALSRLEDADVVEARISFTDARKRLYTLAI---------------------------
23680|gene|hbo      YALSRLEEADAVNSRFSFSDARKRLYTLNL---------------------------
852|hp|hvo          YALSRLEDEGAVDSRFSFSDARKRLYTLNI---------------------------
184|gene|hla        YALSRLEEEDVVDSRFSFADARKRLYTLSV---------------------------
13327|hp|hma        YALSRLEDVGVIDSRFSFSDARKRIYTLRVE--------------------------
567|gene|hhi        YALSRLEDVGVIDSRFSFADARKRIYTLQVE--------------------------
                     .*  *:: . :.:* *: *****:*:*