HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0730arCOG04588hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0730 nrc1 VNG0429 vng429 no entry
tucHOG0730 hmu HMUK3067 Hmuk_3067 conserved hypothetical protein
tucHOG0730 hma RRNAC0664 hypothetical protein
tucHOG0730 hwa HQ2393A hypothetical protein
tucHOG0730 hla HLAC0836 Hlac_836 hypothetical protein
tucHOG0730 hbo HBOR18470 Hbor_18470 hypothetical protein
tucHOG0730 hut HUTA0873 Huta_0873 conserved hypothetical protein
tucHOG0730 hvo HVO_1388 HVO_1388 conserved hypothetical protein
tucHOG0730 nph NP0370A hypothetical protein
tucHOG0730 hhi 1318 HAH_1318 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


429|hp|nrc1       MTLSAEAHERLADLVALQPTKNSDLQDRWGLDSGSAVHQYLESHLREYYYRDEDSMIRAT
836|hp|hla        MSLTDEELSRLADIVRLQPTKNGELQDAWGLDSGSEVHQYLENHLKEYYYRDDDSLIRST
2393|hp|hwa       MVLSKQAKKRLADVVQLQPTKNKELQERWGIDSGSEIHQYLESELGEYYYRDDNSLIRAT
18470|hp|hbo      MTLSEEAKERLADVVRLQPTKNKELQEQWGLESGSEVHQYLENNLKEYYYRDDNSLIRAT
873|chp|hut       MTLSDEALQRLADVVALQPTKNAELQGEWDLESGSEVHQVLESDLGEYYYRDEDSLIRAT
370|hp|nph        MTLSEEAESRLADIVSLQPTKNSELQERWGLDGGSEVHQYLESELKEYYYRDENSLIRAT
10664|hp|hma      MTLSEEARERLADIVELQPTKNGELQERWDMDSGSEVHQYLEAELKEYYYRNDNSLICAT
1318|hp|hhi       MTLSEEARERLADIVELQPTKNGELQERWDMDSGSEVHQYLESELKEYYYRNDNSLICAT
                  * *: :  .****:* ****** :**  *.::.** :** **  * *****:::*:* :*

429|hp|nrc1       AEASTLVG----DDDADEAPA-----VHMSDTERLVFDVIAGPEDRSQSVVSVLHAVQDE
836|hp|hla        AEANDLVDVEPGIEADAVAKGAAPETIRVPELEARVFEVVAGPDERSQSVVAVLNAVREA
2393|hp|hwa       EDAAELVDVAPGVEGSEDNDG-IPSIIRVPELHVRVFTVLAGPEDRSQSVVSVLNDVREE
18470|hp|hbo      AEAAELVDVDPGVEVGESEDE-VPSVIRVPALETRVFEVLAGPDERSESVVSVLNKIREE
873|chp|hut       PEAAELVEREGLVEGGNDDLT-----VHVSALQCRVLEVIAGPEAEPQSVVSVLQDVRET
370|hp|nph        PEAAELVG----IDTDEDI-------VRVPPLQSDIIDVLAGPDGEPQSVVSVLHDLEDA
10664|hp|hma      PEATTLID----GEDSERIQT-----VTVTSLQQAVVDVIAGPDEESQSVVAVLHALREV
1318|hp|hhi       PEATTLID----GEDSERIQT-----VTVTPLQQAIVDVIAGPDEESQSVVAVLHALREV
                   :*  *:      :            : :.     :. *:***:  .:***:**: : : 

429|hp|nrc1       HGADADGLDAGGVRRALQTLKRKGIIEVENRTVPTFRLAVPRQEVTVADD----------
836|hp|hla        FDLDP---DVDEVRRALRSLERKNVVEVVYRTVPTFRLAVERDEITVEIAE---------
2393|hp|hwa       FDVDP---SVEDVRAALQSLRQKDVVTVVYRTVPTFQLATPRDMVDVEQTQQSDIDDAAD
18470|hp|hbo      FDEDP---DVDAVRRALQSLRRKGVVEVVYRTVPTFHLAVERDEVDVEVTD---------
873|chp|hut       -GEDP---SVDDVRSALGSLTDKGILERVRTTVPTYRLAVERDELTVEKRE---------
370|hp|nph        -GIET---DVDAVRSGLRSLEDKGIVAVIKKTVPTFRLAVERDDIEVETLEEPAHA----
10664|hp|hma      -GEDR---DTDDVRSALRSLADKGIVETVEKTVPTFRLAVPRDELDIELSEE--------
1318|hp|hhi       -GEDR---DTDDVRSALRSLADKGIVETVEKTVPTFRLAVPRDELDIELSEE--------
                   . :    ..  ** .* :*  *.::     ****:.**. *: : :             

429|hp|nrc1       --------------------------------------------------
836|hp|hla        --------------------------------------------------
2393|hp|hwa       VNSTHTDVNTHSEPTANTGDTSQHSTLNTDTDAVQSDTLEQIETEFEDVN
18470|hp|hbo      --------------------------------------------------
873|chp|hut       --------------------------------------------------
370|hp|nph        --------------------------------------------------
10664|hp|hma      --------------------------------------------------
1318|hp|hhi       --------------------------------------------------