HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0073COG1028KOG1611 KOG0725 KOG1201 KOG1204 KOG1205 KOG1208 KOG1209 KOG1210arCOG01259Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)oxidoreductase

HOG Organism Gene ID Name Annotation
cHOG0073 nrc1 VNG0364 yusZ3 oxidoreductase
cHOG0073 hmu HMUK2968 Hmuk_2968 short-chain dehydrogenase/reductase SDR
cHOG0073 hma RRNAC0677 yusZ4 short-chain dehydrogenase/oxidoreductase
cHOG0073 hma RRNAC2793 yusZ3 oxidoreductase
cHOG0073 hwa HQ1235A short chain dehydrogenase/ reductase
cHOG0073 hla HLAC0964 Hlac_964 short-chain dehydrogenase/reductase SDR
cHOG0073 hbo HBOR24900 Hbor_24900 Short-chain dehydrogenases of various substrate specificities
cHOG0073 hut HUTA2453 Huta_2453 short-chain dehydrogenase/reductase SDR
cHOG0073 hut HUTA2526 Huta_2526 short-chain dehydrogenase/reductase SDR
cHOG0073 hvo HVO_0725 HVO_0725 oxidoreductase
cHOG0073 nph NP1160A dehydrogenase/ reductase 7
cHOG0073 hhi 1330 yusZ2 short chain dehydrogenase/reductase
cHOG0073 hhi 74 yusZ1 oxidoreductase
MUSCLE (3.6) multiple sequence alignment


12793|gene|hma      ------MSTGASVVLLTGAASGIGAATARAFADDGWTVYATDVRTEFPADIP--ERCRCL
74|gene|hhi         ------MSTSNSVVLLTGAASGIGAATARAFVDDGWTVYATDVRAEFPADIR--ERCRCL
2526|gene|hut       ----------METVLVTGAGSGIGRATARQFSDDGWQVYAVDVDADGLGDLD---GCETA
10677|gene|hma      ---------MAKTVLITGASSGIGRASAEAFLADDWTVWATAREESDIEDLE-DAGCKTA
1330|gene|hhi       ---------MAKTVLITGASSGIGRASAEAFLADDWTVWATAREESDIEDLG-EDGCETA
2453|gene|hut       --------MEDHIALITGCSSGIGRASAERFLEEDWTVYATARDTDDIADLA-DAGAETA
364|gene|nrc1       ---------MEKVALVTGCSSGVGAATVRSLTDEEWRVVATARDTADLVALAEETGCETA
1160|gene|nph       --------MSTRTVLITGCSSGIGRAAAYAFLENEWRVYATARNPADIQTLG-EAGCDIG
1235|gene|hwa       ---------MQQTVLITGCSSGIGRAAAHMFLEADWRVYATARNPADIETLG-ERGCQIA
964|gene|hla        MPPGTDRRPVQKTVLITGCSSGIGRAAAHAFLDEGWTVYATARNPADIETLG-EAGCELA
24900|gene|hbo      --------MHPKTVLITGCSSGIGRATALAFLEEDWRVYATARNPADIETLG-EKGCELA
                                 .*:**..**:* *:.  :    * * *.         :     .   

12793|gene|hma      ELDVTDSEQVEAVVDHIIEEAGRLDCLVNNAGYGVAGPVEDVSSDDVREQFDVLVHGPHR
74|gene|hhi         ELDVTDEAQIEAVVDQVIEETGRLDCLVNNAGYGVAGPVEDIASDDVREQFDVLVHGPHR
2526|gene|hut       TLDVTDSAALDRLYDRISAEAGGLDCVVANAGYCQPGPLEDLPAERLDRQFAVNVHGTLR
10677|gene|hma      ELDVTNPRECERVVEALIESEGRLDCLINNAGYAQFGAVEDVSTADLHDQFDVNLYGPHR
1330|gene|hhi       ELDVTNPRECERVVESLIEAEGRLDCLVNNAGYPQFGAVEDVSTAALHEQFDVNLYGPHR
2453|gene|hut       KLDVTNARAVERVVDRIIDEEGRIDCLVNNAGTGQFGPIEDVPTDALQDQFDVNLYGPHR
364|gene|nrc1       ELDVTKPAQCRAVVDDAVDDHGRLDCLVNNAGFAQLGPLEDVPPRKLHRQFDVNVYGPHR
1160|gene|nph       TINVRSTEDVERVVDRVIDEAGRIDALVNNAGYGQHGPIEDINDELFEKQFDVNVFGPHR
1235|gene|hwa       TLDVTDDDDIDRVVDRIEDESGSVSCLVNNAGFGQFGAIEDIPTSQVHRQFDVNLYGPHR
964|gene|hla        TLDVTDQSDVDRVVDRILDEEGAIDAVVNNAGYGQFGPVEDVPTAKVHEQFDVNVYGPHR
24900|gene|hbo      TLDVTDGDDVERVIDRIIEEEGHLTCVVNNAGYGQFGPLEDVPTEQVHRQFDVNVYGPHR
                     ::* .      : :      * : .:: ***    *.:**:    .  ** * :.*. *

12793|gene|hma      LAQAVLPEMREHG-GRIITVSSVLGHTASPGLGAYSAGKAAVESLSDAVRIEVAGADDIH
74|gene|hhi         LAQAVLPEMREHG-GRIITVSSVLGHTASPGLGAYSAGKAAVESLTDALRIEIAGEDDIH
2526|gene|hut       TITTGLPLLRERD-GTAVVVSSTHGRVVTPGMGAYAGSKHAIEGVADTLRIEVA-DQPVD
10677|gene|hma      LIREALPHMRARENGTIVNVSSVAGRIAFPNQGSYAASKFALEGLSDALRMEVE-EFGID
1330|gene|hhi       LIREALPHMRARENGTIVNVSSVAGRIAFPNQGGYAASKFALEGLSDALRMEVE-EFGID
2453|gene|hut       LIRAVLPHMREQAEGTIVNVSSLQGRLAVPGMGAYAASKFALEAMSDSLRAEVD-SHGVD
364|gene|nrc1       LIRAALPHMRERGEGTIVNVSSVSGRVATPGMGAYNGSKFALEGLSDALRGEVA-EHGID
1160|gene|nph       LVRAVLPHMRERRDGTIINVSSVAGRLAAPGMGVYSASKHAIEGYSDSLRRELE-PFDID
1235|gene|hwa       LIRAVLPKMRENEAGTIINISSVAGQVSFPTGGVYAGSKAALEAMSDALRNEVA-PYDID
964|gene|hla        LIKAVLPGMRRERDGTIVNVSSVAGRVSFPGGGVYSGSKFAIEALSDALRNEVA-EFGID
24900|gene|hbo      LIRAALPHMRRQGDGTIVNVSSVAGQISFPGGGVYSGSKFALGAMTDALRNEVS-EYGVD
                         ** :*    *  : :**  *.   *  * * ..* *: . :*::* *:     : 

12793|gene|hma      ISLVEPAWVETGFADGALESLR-----------------------DADRTPTYDRTYDAL
74|gene|hhi         VSLVEPAWVDTGFADSALGSLN-----------------------DEDRTPTYNRTYEAL
2526|gene|hut       VALVAPAWVDTDFSAESDHLLS-----------------------GFERSDRYADIYDAL
10677|gene|hma      VVLVEPGPVETNFDNRADEELD-----------------------DLDTSGAYDWLYQAH
1330|gene|hhi       VVLVEPGPVETNFDDRAEEELD-----------------------ELDKSGAYDWLYQAH
2453|gene|hut       VVVVEPGVVETSFADRTDASRE-----------------------RLEQSGAYDGIYEAQ
364|gene|nrc1       VAVVEPGPVDTGFQDRADAELD-----------------------ALDRSGGYERIYSWF
1160|gene|nph       VSVVQPGPVETSFRDRVDDELG-----------------------RLDRTDAYEDLYAFQ
1235|gene|hwa       VVIIEPGPVETAFPDRAAREFQDETKENSIAD----------DTQQIERSGAYESLYELL
964|gene|hla        VVVVEPGPVRTNFSKRAEREAGGGDADDEATEGSRSADGSETDDAGLDRSGAYEEFYEIF
24900|gene|hbo      AVLVEPGPVATNFTERVEAEVEGSE-----------------ELPGVERSGAYESFYELL
                      :: *. * * *                                  : :  *   *   

12793|gene|hma      EDGWVLTG-GPLATTPEAVAATVLAAATDDPPKARYPVGAFATFVRWTHWLPARLQDPIH
74|gene|hhi         EDGWVLTG-GPLATTPEAVAATVLAAATDDPPKARYPVGKFATFVRWTHWLPARLQDPIH
2526|gene|hut       EGQALLGG-GPLAVSPERVAAAIQDAATADDPAARYPVGLPARLVLATRWLPRPVQDLGQ
10677|gene|hma      EDSNLVGIQDALSVTPGTVALTIRDAANASDPEPRYPVGQGAQLLLMLDYLPARWRDAAF
1330|gene|hhi       EDSNLVGIQDALSVTPGTVALTIRDAASASDPEPRYPVGQGAQLLLMLDYLPARWRDAAF
2453|gene|hut       DDRRAIEYDGVFGIPPEDVATVIYDAAAMTDPDPRYAVGNGAKLILALRYLPDRWRDAAF
364|gene|nrc1       EDASAVN--GVGAVSPERVADVIATAAVSPNPAARYPVAQAGRVGVLARFLPDRLLDAGY
1160|gene|nph       EDASLFGGDSPVASHPGEVADVILEAASSTDPQPRYVVGTAAQLLVYASYLPDPIADSVF
1235|gene|hwa       TDTKLVGGGGFGAVSAERVAEDILDAASSTSPQPRYQTGATARVGVLARFVPSTWRDTLY
964|gene|hla        EDTQLLGGDGPGAIEPEVVADAIVNAASATQPPARVQPGTAARIGVLARFLPDAILDAGY
24900|gene|hbo      SDTQLLGGGGPAAISPERVAEDIVDAASSTKPRARYYPGTPARIAALARVLPNSWVDTAY
                     .   .   .  .  .  **  :  **    * .*   .  . .      :*    *   

12793|gene|hma      RGFGRASALLGRWL-----
74|gene|hhi         RGFGRASSFLGRWLR----
2526|gene|hut       RVAIRTLAAIERFREAIDG
10677|gene|hma      GVIRKLTR-----------
1330|gene|hhi       GVIRKLTS-----------
2453|gene|hut       GLFQRVAGLRR--------
364|gene|nrc1       RVLLRVLT-----------
1160|gene|nph       DAIRRFVS-----------
1235|gene|hwa       QKLQSL-------------
964|gene|hla        DFVRKFTS-----------
24900|gene|hbo      SYLRKLA------------