HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0729COG1675KOG2593arCOG04270Transcription initiation factor IIE alpha subunittranscription initiation factor IIE alpha subunit

HOG Organism Gene ID Name Annotation
cHOG0729 nrc1 VNG0757 tfeA transcription initiation factor IIE alpha subunit
cHOG0729 hmu HMUK2330 Hmuk_2330 Transcription factor TFIIE, alpha subunit
cHOG0729 hma RRNAC0861 tfeA transcription initiation factor IIE alpha subunit
cHOG0729 hwa HQ2491A tfeA transcription initiation factor IIE alpha subunit-like protein
cHOG0729 hla HLAC1708 Hlac_1708 Transcription factor TFIIE, alpha subunit
cHOG0729 hbo HBOR20670 Hbor_20670 Transcription factor IIE (TFIIE), alpha subunit
cHOG0729 hut HUTA0285 Huta_0285 Transcription factor TFIIE, alpha subunit
cHOG0729 hvo HVO_1174 HVO_1174 TFIIE alpha subunit
cHOG0729 nph NP4106A hypothetical protein
cHOG0729 hhi 1499 tfeA transcription initiation factor IIE alpha subunit
MUSCLE (3.6) multiple sequence alignment


285|gene|hut        ---------MAFEEYLEDPVIQKYLHELVGPTGMPVAAAPPDGEVTDEELAEELGLELND
757|gene|nrc1       MALRPPVSTMAFEDLLDDPVVQKYLHELVGPKGMPVAAAPPDGEVTDEELAERLGLELND
1708|gene|hla       ---------MAFEDLLNDPVIQKYLHELVGPTGMPVAAAPPDGEVTDEELAEELGLELND
2491|gene|hwa       ---------MAFDELLNDPVIQKYLHELVGPTGMPVAAAPPDGEVTDEELAEELGLELND
20670|gene|hbo      ---------MAFEGLLNDPVIQKYLHELVGPTGMPVAAAPPDGEVTDEELAEELGLELND
4106|hp|nph         ---------MAFEDLLNDPVIQKYLHELVGPTGMPVAAAPPDGEVTDEELAEELGLELND
10861|gene|hma      ---------MAFEELLEDPVIQKYLHELVGPKGMPVAAAPPDGEVTDEELAEELGLELND
1499|gene|hhi       ---------MAFEELLEDPVIQKYLHELVGPKGMPVAAAPPDGEVTDEELAEELGLELND
                             ***:  *:***:**********.******************** *******

285|gene|hut        VRRALFILYENDLASYRRLRDEDSGWLTYLWTFEYDNIPEQLESEMHDLFEGLEERREYE
757|gene|nrc1       VRRALFILYENDLATYRRVRDEDSGWLTYLWTFQYENVPGNLREEMDRLLEALVDRREYE
1708|gene|hla       VRRALFILYENDLATYRRVRDEDSGWLTYLWTFHYDNIPENLEEEMYRLLDALEEREEYE
2491|gene|hwa       VRRALFILYENDLATYRRVRDEDSGWLTYLWTFHYENIPENLQSEMYRLLDALEERLEYE
20670|gene|hbo      VRRALFILYENDLASYRRVRDEDSGWLTYLWTFHYENIPENLEEEMYRLLDALEERLEYE
4106|hp|nph         VRRALFILYENDLASYRRLRDEDSGWLTYLWTFQYENIPEQLEEEMHRLLEALENRRQYE
10861|gene|hma      VRRALFILYENDLATYRRLRDEDSGWLTYLWTFQYEKIPEQLQEEMHRLLDGLEERREYE
1499|gene|hhi       VRRALFILYENDLATYRRLRDEDSGWLTYLWTFQYEKIPEQLQEEMHRLLDGLEERREYE
                    **************:***:************** *:::* :* .**  *::.* :* :**

285|gene|hut        LDHEFYLCENCGIRFEFADAMDYGFECPDCGSSLEAMENTALITAMDERIDELESELNLD
757|gene|nrc1       LENEFYLCEVCSIRFEFGEAMDLGFECPECGSAVEAMENTDLVDAMDDRIERLRSELAVE
1708|gene|hla       RTHEFYLCEVCSIRFEFGEAMDFGFECPECGSPVEAMDNDRLREAMGQRVEKLRNELNVD
2491|gene|hwa       RSHEFYLSEPAGIRFEFSEAMELGFQCPETGAPLEPIENQEMINAMERRIDSLQSELNVG
20670|gene|hbo      RTHEFYLSEPAGIRFEFSEAMELGFQCPETGAPLEPMENDDMVDAMERRIEELRDELNVE
4106|hp|nph         SENEFYLCGECQLRFEFDEAMEFGFECPECGGRLESMENDRLVNAMEQHIEALRDELHVE
10861|gene|hma      RENEFYLCEHCGIRFEFGEAMEFGFECPECGNQVETMENTRLVTAMENRLEELRDELNAD
1499|gene|hhi       RENEFYLCEHCGIRFEFGEAMEFGFECPECGNQVETMENTRLVTAMENRIEELRDELNAD
                      :****.  . :**** :**: **:**: *  :*.::*  :  **  .:: * .**   

285|gene|hut        IDT--
757|gene|nrc1       A----
1708|gene|hla       VTG--
2491|gene|hwa       VTQTV
20670|gene|hbo      ATN--
4106|hp|nph         TAEA-
10861|gene|hma      VDVEA
1499|gene|hhi       VDVEA