HOG COG KOG arCOG COG description NRC-1 annotation
nucHOG0728arCOG04162membrane anchor

HOG Organism Gene ID Name Annotation
nucHOG0728 nrc1 VNG1309 sdhD membrane anchor
nucHOG0728 hmu HMUK2077 Hmuk_2077 succinate dehydrogenase subunit D (EC 1.3.5.1)( EC:1.3.99.1 )
nucHOG0728 hma RRNAC1092 msmX-2 sugar ABC transporter ATP-binding protein
nucHOG0728 hwa HQ2996A sdhD succinate dehydrogenase, subunit D (membrane anchor protein)
nucHOG0728 hla HLAC1988 Hlac_1988 succinate dehydrogenase, subunit D (membrane anchor protein)
nucHOG0728 hbo HBOR12890 Hbor_12890 succinate dehydrogenase subunit D( EC:1.3.99.1 )
nucHOG0728 hut HUTA2834 Huta_2834 succinate dehydrogenase, subunit D (membrane anchor protein)
nucHOG0728 hvo HVO_2810 HVO_2810 sdhD succinate dehydrogenase chain D homolog
nucHOG0728 nph NP4268A sdhD succinate dehydrogenase, subunit D (membrane anchor protein)
nucHOG0728 hhi 1704 sdhD succinate dehydrogenase subunit D (membrane anchor protein)
MUSCLE (3.6) multiple sequence alignment


10920|gene|hma      MARVQLEHVTKRYDDQGDVVTAVDDMNLDIDHGEFICFVGPSGCGKSTTMETIAGLTIPT
1309|gene|nrc1      --------MAKRYS------------------------------------------SFRS
1988|gene|hla       --------MAERYS------------------------------------------SFNS
12890|gene|hbo      --------MAEHYS------------------------------------------SFER
2996|gene|hwa       --------MAEHYS------------------------------------------SFKR
1704|gene|hhi       --------MAEHYS------------------------------------------SFDR
2834|gene|hut       --------MAEYYS------------------------------------------SFES
4268|gene|nph       --------MAEHYS------------------------------------------SFEP
                            ::: *.                                          ::  

10920|gene|hma      EGEIYIGDREVTNLPPKDRGIAMVFQNIALFPHMDVYDNISFGLRLRDYPQDEIDRRVER
1309|gene|nrc1      GSTTWLLQR-----------LTAGFLVVVLAFHF-------FNLHFVNHAYN--------
1988|gene|hla       GGRMWLLQR-----------VTAAFLLIVLAFHF-------FLLHFVHHADE--------
12890|gene|hbo      GGRRWLWQR-----------ITAAFLVVVLAFHF-------FLLHFVHHAAD--------
2996|gene|hwa       GGRRWLWQR-----------ITAAFLVVVLAFHF-------FLLHFVHHADE--------
1704|gene|hhi       GGRRWLFQR-----------LTAVFLVGVLAFHF-------MLLHFVNHAAD--------
2834|gene|hut       GGTRWFLQR-----------ITAVILIGTLAFHF-------FLLHFVNHAAE--------
4268|gene|nph       KGTRWLLQR-----------ITAVFLVAVLAYHF-------MLLHFVNHAAE--------
                     .  :: :*           ::  :   .*  *:       : *.:  :. :        

10920|gene|hma      AADIVQLEGMLNRMPEEMSGGQRQRVAIARAIVREPDVFLMDEPLANLDAKLKVHMRTEL
1309|gene|nrc1      ----IDFAGSQVRM---------QSLGYYVTMV----LFLVTATFHGVNG----------
1988|gene|hla       ----VTLAASSARM---------EQLSYYSLMV----LFLVTATFHGVNG----------
12890|gene|hbo      ----VTFQMSAARM---------QQWTYYSLMV----LFLITATFHGVNG----------
2996|gene|hwa       ----VTFAMSQGRM---------QELTYFSLMV----LFLVTATFHGVNG----------
1704|gene|hhi       ----LTFLGTQARM---------NRPWYLITMW----LFLVTATFHGVNG----------
2834|gene|hut       ----IELAGTQARM---------SQVGYFTTMV----VFLVAATFHGVNG----------
4268|gene|nph       ----ITFAGTQARM---------SEVGYFITMV----LFLIAGAFHGVNG----------
                        : :     **         .       :     :**:  .: .::.          

10920|gene|hma      QRLHKELDTTIIYVTHDQEEAMTLSDRIAVLDSGQLQQIDPPLTCYNEPDNLFVAGFIGS
1309|gene|nrc1      --------------------------------------------VYNA---LVNQGIEGN
1988|gene|hla       --------------------------------------------VYNA---LINQGLTGT
12890|gene|hbo      --------------------------------------------VYNA---LVNQGIEGT
2996|gene|hwa       --------------------------------------------VYNA---LINQGLSGT
1704|gene|hhi       --------------------------------------------VYNA---LVNQGLTGS
2834|gene|hut       --------------------------------------------IYNA---LLNQGISGT
4268|gene|nph       --------------------------------------------VYNA---LVNQGLKGT
                                                                 **    *.  *: *.

10920|gene|hma      PSMNFVEGTVTETTLETPNFSLEFNPSSIEGVGVGDNVTLGIRPEDIYPGDLQSEVPDPS
1309|gene|nrc1      AK------RAAQLVLGVAGVLLIVQ---------------GIRVANALAGF---------
1988|gene|hla       KR------TVVKWTLVAASVVLLFQ---------------GIRTANAWAGGFPLL-----
12890|gene|hbo      RK------TAVKWTLIAASILLIVQ---------------GIRTANEWAGIALLPF----
2996|gene|hwa       RR------KATKVVLGVASIVLIVQ---------------GVRTAIAWAGGIPI------
1704|gene|hhi       RK------NAVKYLLGIAGILLIVQ---------------GTRVSLAMTTLV--------
2834|gene|hut       PK------RVAKYGLTLAGVLLIGQ---------------GIRVAFAMAGITL-------
4268|gene|nph       QK------TVVKWLLIVAGALLIVQ---------------GIRVAIAMTGLF--------
                             ..:  *  ..  *  :               * *     .           

10920|gene|hma      GMITATTDILEPMGDEIFAYLLLGDGETSMSQELATNDQLLMSIDPDSDLEEDEELGVVI
1309|gene|nrc1      ------------------------------------------------------------
1988|gene|hla       ------------------------------------------------------------
12890|gene|hbo      ------------------------------------------------------------
2996|gene|hwa       ------------------------------------------------------------
1704|gene|hhi       ------------------------------------------------------------
2834|gene|hut       ------------------------------------------------------------
4268|gene|nph       ------------------------------------------------------------
                                                                                

10920|gene|hma      DRRNVHLFDSATGEAIVHDLIPYEAEGTASSSEVESDD
1309|gene|nrc1      --------------------------------------
1988|gene|hla       --------------------------------------
12890|gene|hbo      --------------------------------------
2996|gene|hwa       --------------------------------------
1704|gene|hhi       --------------------------------------
2834|gene|hut       --------------------------------------
4268|gene|nph       --------------------------------------