HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0727arCOG04550hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0727 nrc1 VNG1220 vng1220 no entry
tucHOG0727 hmu HMUK2634 Hmuk_2634 conserved hypothetical protein
tucHOG0727 hma RRNAC0117 hypothetical protein
tucHOG0727 hwa HQ2973A hypothetical protein
tucHOG0727 hla HLAC1838 Hlac_1838 hypothetical protein
tucHOG0727 hbo HBOR12670 Hbor_12670 hypothetical protein
tucHOG0727 hut HUTA0669 Huta_0669 conserved hypothetical protein
tucHOG0727 hvo HVO_2796 HVO_2796 conserved hypothetical protein
tucHOG0727 nph NP4144A hypothetical protein
tucHOG0727 hhi 870 HAH_0870 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1220|hp|nrc1      MAEMEDPSGRDWVHDPDGEHGSEGGRKYGLAVLSKMTVEGEDFPLDAAEFVAEYGEYPVR
669|chp|hut       ---------MDWPHDPDSDEGSEGRRKYGQAIVAKKLD-AEDFPVSTGAFVETYGDHPVR
4144|hp|nph       ---------MDWPHDPDGEEGSEGKRKYGQAILAKKLDEEGDFPLSASDFVDEHGDEPVR
2973|hp|hwa       ---------MEWPHDPDGEQGSEGRRKYGHAVIAKKVNEDEDFPLDCDAFVSEYGDHPVR
12670|hp|hbo      ---------MDWPHDPDSEEGSEGMRKYGQAIIAKKVDEDEDFPLSTAEFVEEHGDDPIR
10117|hp|hma      ---------MDWPHDPDGEEGSEGRRKYGHAVLAKKVDEDEDFPLTAEEYVEQYGDHPVR
870|hp|hhi        ---------MDWPHDPDGEEGSEGRRKYGHAVLAKKVDEDEDFPLTAEEYVEQYGDHPVR
1838|hp|hla       ---------MDWPHDPDGEQGSEGRRQYGHAVLAKKINEEEDFPLSAADYVEQYGDHPIR
                            :* ****.: **** *:** *:::*      ***:    :*  :*: *:*

1220|hp|nrc1      LNHQTVVSVADIFEHIDADEFETKVGFHKTVGAALQDADFLDYHPDA---------
669|chp|hut       IDHEQVVSVGDIFEHVDDAEFDDFPAFHTAVGAAMREAGYWPLERDHA--------
4144|hp|nph       LNHSEVVSVADIFEHVDQSEFDDIVSFHKAVGQAMRNADMWEVDVEKHA-------
2973|hp|hwa       IDNKTVISVADVFEHVEEAEFADFIEFHQALGRAMRQGDLWSYEGAEEFVGTESEA
12670|hp|hbo      IDYETVVSLRDIFENVEEESFEAFVPFHKAVGRAMRENGYWFYEGADQFAETKNSA
10117|hp|hma      IDYETVVSVADIFEYVDQEEFEDFPDFHKSLGRALREADWWPYRLEQA--------
870|hp|hhi        IDYETVVSVADIFEYVDQEEFEDFPDFHKSLGRALREADWWPYRLEQA--------
1838|hp|hla       IDYETVVSVEEIFGGVEKEEFGDFVEFHQELGRAMRENGYWFYEGAEQFVDGSA--
                  :: . *:*: ::*  ::  .*     **  :* *:.: .