HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0726COG2004KOG3424arCOG04182Ribosomal protein S24E30S ribosomal protein S24E

HOG Organism Gene ID Name Annotation
cHOG0726 nrc1 VNG2048 rps24e 30S ribosomal protein S24E
cHOG0726 hmu HMUK1171 Hmuk_1171 Ribosomal protein S24e
cHOG0726 hma RRNAC2488 rps24e 30S ribosomal protein S24e
cHOG0726 hwa HQ1340A rps24e 30S ribosomal protein S24e
cHOG0726 hla HLAC2393 Hlac_2393 Ribosomal protein S24e
cHOG0726 hbo HBOR05010 Hbor_05010 SSU ribosomal protein S24E
cHOG0726 hut HUTA1956 Huta_1956 Ribosomal protein S24e
cHOG0726 hvo HVO_1896 HVO_1896 Ribosomal protein S24e
cHOG0726 nph NP5074A rps24e 30S ribosomal protein S24e
cHOG0726 hhi 2920 rps24e 30S ribosomal protein S24e
MUSCLE (3.6) multiple sequence alignment


2048|gene|nrc1      MEIEILGQEDNPLLHRTDVQFKIVHDDATPSRLSVRDSLAAKLDKDSEEVVVHELDTKFG
1340|gene|hwa       MEVDILSEDENSMLHRTDIQFEIAHEDATPSRLSVRDSLAAKINKDSDEVVVHKLDTKFG
5074|gene|nph       MDVDIIDEDENPMLHRTDVRFQLTHEEATPSRLSVRDSLAAKLNKDASEVVVRKLDTKYG
2393|gene|hla       MDVDIISEEENPMLHRTDIRFETTHEEATPSRLSVRDSLAAKLDKASEEVVVHELDTKFG
5010|gene|hbo       MEIEVISEDENPMLHRTDVRFEIVHDEATPSRLSVRDSLAAKLNKDSDEVVIHELDTKFG
12488|gene|hma      MDIDIIEEDENPMLHRTDVRFEVVHDEATPSRLSVRDSLAATLNKDAEEVVIHKLDTKFG
2920|gene|hhi       MDIDIIEEDENPMLHRTDVRFEVVHDEATPSRLSVRDSLAATLNKDAEEVVIHKLDTKFG
1956|gene|hut       MDIEIIEEEDNPMLHRTDVRFEVVHEEATPSRLSIRDSLAAMLNKDAAEVVVHELDTTFG
                    *::::: :::*.:*****:.*: .*::*******:****** ::* : ***:.:***.:*

2048|gene|nrc1      MRKTRGRAKVYDSPAQAAEVEHDHMLERNKI----GADDADAEEAE
1340|gene|hwa       MRKTIGYAKVYDSPQSARQVEQDYMLKRNKIEIESEDEDSAAEGA-
5074|gene|nph       MRKTVGHAKVYDSADDAKAVEQDHALERNKIEADEEADEEAAEEA-
2393|gene|hla       MRKTIGYAKVYDTAEDALDVEQEYMLERNKI---GGEVEADAEEA-
5010|gene|hbo       MRKTAGYAKVYESPEFARDVEQDYMLDRNKIEAEEGDAEAEAEEA-
12488|gene|hma      MRKTVGYAKVYDNPEYARDVEQDHMLERNKIVA-DG--EEEAEEA-
2920|gene|hhi       MRKTVGYAKVYDNPEYARDVEQDHMLERNKIVA-DG--EEEAEEA-
1956|gene|hut       MRKTVGYAKVYDDPEFAREVEQDHMLERNKIVAEDG--ESEAEEA-
                    **** * ****: .  *  **::: *.****       :  ** *