HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0725COG0131KOG3143arCOG04398Imidazoleglycerol-phosphate dehydrataseimidazoleglycerol-phosphate dehydratase

HOG Organism Gene ID Name Annotation
cHOG0725 nrc1 VNG2295 hisB imidazoleglycerol-phosphate dehydratase
cHOG0725 hmu HMUK0863 Hmuk_0863 Imidazoleglycerol-phosphate dehydratase( EC:4.2.1.19 )
cHOG0725 hma RRNAC2555 hisB imidazoleglycerol-phosphate dehydratase
cHOG0725 hwa HQ1026A hisB imidazoleglycerol-phosphate dehydratase
cHOG0725 hla HLAC2701 Hlac_2701 imidazoleglycerol-phosphate dehydratase
cHOG0725 hbo HBOR02590 Hbor_02590 imidazoleglycerol-phosphate dehydratase( EC:4.2.1.19 )
cHOG0725 hut HUTA2124 Huta_2124 Imidazoleglycerol-phosphate dehydratase
cHOG0725 hvo HVO_2986 HVO_2986 hisB imidazoleglycerol-phosphate dehydratase
cHOG0725 nph NP2258A hisB imidazoleglycerol-phosphate dehydratase
cHOG0725 hhi 2983 hisB imidazoleglycerol-phosphate dehydratase
MUSCLE (3.6) multiple sequence alignment


2295|gene|nrc1      --------MT-----DRTAAVTRETAETDVAVTLDLDGDGEHTVDTGIGFFDHMLAAFAK
1026|gene|hwa       MTEDTETSSTGAGADDRTAAISRETAETTINVTLAVDGDGEATVDTGIGFFDHMLETFAK
2701|gene|hla       ------MSDH-----ERAAAVSRETSETTIDLTLAIDGDGDSEVDTGIGFFDHMLSSFAK
2124|gene|hut       --------MT-----DRTAAVTRETGETDIEVTLDLDGDGESTIETGIGFFDHMLDAFAT
12555|gene|hma      --------MT-----DRTAAVTRTTAETDIEVTLDVDGDGDSTIDTGIGFFDHMLDSFST
2983|gene|hhi       --------MT-----DRTAAVTRTTAETDIEVTLDVDGDGDSTIDTGIGFFDHMLDSFST
2590|gene|hbo       MSDDADSDAT-----SRTAAVSRETAETTIEVTLTIDGDGDATVDTGVGFFDHMLEAFAK
2258|gene|nph       --------MT-----DRTAAATRETAETEIEVTLDLDGDGESTVDTGIGFFDHMLEAFAK
                                   .*:** :* *.** : :** :****:  ::**:******* :*:.

2295|gene|nrc1      HGLFDVTVRCDGDLDVDDHHTVEDVGIALGAAFSEAVGEKRGIQRFADRRVPLDEAVASV
1026|gene|hwa       HGLFDLTVRCDGDLDIDDHHTVEDVGIVLGKSFNNALGEKRGIVRYADRSVPLDEAVATV
2701|gene|hla       HGLFDLTVNCDGDTEIDDHHTVEDVAICLGEAFDEALGDKRGIRRYADRRVPLDEAVASV
2124|gene|hut       HGLFDLTVRCDGDLAVDDHHTVEDVAITLGEAVTEALGEKRGIDRFADRRVPLDEAVATV
12555|gene|hma      HGLFDLTVQCDGDLDIDDHHTVEDVAITLGEAFTEALDDKRGIRRFADRKVPLDEAVASV
2983|gene|hhi       HGLFDLTVQCDGDLDIDDHHTVEDVAITLGEAFTEALDDKRGIRRFADRKVPLDEAVASV
2590|gene|hbo       HGLFDLTVNCDGDLEIDDHHTVEDVAIVIGDAFSEALGDKRGIVRYADRQVPLDEAVAGV
2258|gene|nph       HGLFDLTVRCDGDLDIDDHHTVEDIGIVLGECLADALGDKRGIVRYADRAVPLDEAVADV
                    *****:**.****  :********:.* :* .. :*:.:**** *:*** ******** *

2295|gene|nrc1      VVDVSGRAVYEFDGGFSQPTVGGLTSRMAAHFWRTFATHAAVTLHCGVD-GENAHHEIEA
1026|gene|hwa       IADISGRPHFEFSGSFSQPQIGGFTSDMARHFAYSFTMHSEITLHASIE-GINAHHEVEA
2701|gene|hla       VVDVAGRPYYEFSGEFSQESVGEFTSVMADHFALSLAHNAGLTLHAAIETGDNAHHEVEA
2124|gene|hut       VVDVSGRPYFEFGGEFSQATVGEFTSVMAKHFLRSLAMNAGLTLHASVE-GENAHHEVEA
12555|gene|hma      VVDISGRPYFEFDGEFSQASVGGMTSHMAKHFCRSLSMNAGLTLHCGVD-GENAHHEIEA
2983|gene|hhi       VVDISGRPYFAFDGDFSQGSVGGMTSHMAKHFCRSLSMNAGLTLHCGVE-GENAHHEIEA
2590|gene|hbo       VVDVSGRPYFDFDGEFSQEQIGDFTSDMARHFGYSLAMHAGLTLHTEIR-GENAHHEAEA
2258|gene|nph       VVDVSGRPRFYFDGAFSQPYIGEFTSDMARHFAESLALNAGLTLHLSIE-GENAHHEVEA
                    :.*::**. : *.* ***  :* :** ** **  ::: :: :***  :  * ***** **

2295|gene|nrc1      LFKGVGRAVDDATRIDQRRAGETPSTKGDL
1026|gene|hwa       LFKSLARTLDEATQLDPRR-GDTPSTKGEL
2701|gene|hla       LFKALARALDDATRLDGRR-SDTPSTKGEL
2124|gene|hut       LFKGLARALDDATRIDDRR-ADAPSTKGEL
12555|gene|hma      LFKSLARSLDDATRIDERR-SDVASTKGEL
2983|gene|hhi       LFKGLARALDDATRIDERR-SDVASTKGEL
2590|gene|hbo       LFKALARALDDATRVDPRR-SDTPSTKGEL
2258|gene|nph       LFKALARSLDDATRVDDRR-SDTPSTKGEL
                    ***.:.*::*:**.:* ** .:..****:*