HOG COG KOG arCOG COG description NRC-1 annotation
tucHOG0724arCOG04578hypothetical protein

HOG Organism Gene ID Name Annotation
tucHOG0724 nrc1 VNG0906 vng906 no entry
tucHOG0724 hmu HMUK2719 Hmuk_2719 conserved hypothetical protein
tucHOG0724 hma RRNAC0469 hypothetical protein
tucHOG0724 hwa HQ1698A hypothetical protein
tucHOG0724 hla HLAC1033 Hlac_1033 hypothetical protein
tucHOG0724 hbo HBOR22170 Hbor_22170 hypothetical protein
tucHOG0724 hut HUTA2813 Huta_2813 conserved hypothetical protein
tucHOG0724 hvo HVO_1037 HVO_1037 conserved hypothetical protein
tucHOG0724 nph NP3104A hypothetical protein
tucHOG0724 hhi 1169 HAH_1169 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2813|chp|hut      MKREHFSLTAVRAG--EKPDAPDVPTLRITHSGAAAPLRDRLTDDDGATLEGDAVDVAFR
10469|hp|hma      MRRDYFTVDIQ-----ASATDNDDPTIAIVYDGPTGELRERLSKVDGGTLDGEEIDVTFR
1169|hp|hhi       MRRDYFTVDIQ-----ASATDNDDPTIAIVYDGPTGELRERLSKVDGGTLDGEEIDVTFR
3104|hp|nph       MRRDYFTLSKQG----TEADDPATPTLVVGYEGPTEELAERLHD-DGTPLEEDGLDVAYR
1033|hp|hla       MRRDYFELTVEGVD--DDTHRPVTPLVRIDFHGPDGLLRDRLSGTDGTLLAADDVDVAFR
906|hp|nrc1       MRRDYFELDVSNVDWVANGGKPKQPTVVIEFTGDTDALRDRLTDTTGAVLEATETDAAFR
1698|hp|hwa       MRRDYFELDVTDVAWVDNDTDPREPQVRIDFDGPTDVLESQLTDPNGEYLDADETDVAFR
22170|hp|hbo      MRRDYFELDVKHIDWVEEGGDPEKPLVRIDFHGPEGSLMDRLTDADGEHLDAAETDVAFR
                  *.*::* :         .      * : : . *    * ..*    *  *     *.::*

2813|chp|hut      KREQET------GVLSIADRLTGAFICELEADIADVKRVV---------DAAEATDDRYR
10469|hp|hma      RQPESD------GVLSLTNRLTGEYIFEATAPTADIDALVSAA--------DAQEDPQFT
1169|hp|hhi       RQPESD------GVLSLTNRLTGEYIFEATAPTADIDALVSAA--------DAQEDPQFT
3104|hp|nph       LQEPIDIDDPS-GVLAVADRVTGEYVLEVNADAGLVSELVESAR-----DADDPEDGHFR
1033|hp|hla       LREPLSTADDSEGVVGVTNRYTGDFILELNETATDVLPFIHAAR-----DSAGDEDARYR
906|hp|nrc1       LTDAADDTDAA-GVVSVTNRVTGDFILELNVAADDVTQFVRAARRYGESDAARDADGRYR
1698|hp|hwa       LQGSVEDPDAS-GVVSVTNRITGDFILELNESADSVLSFIRAAREYGHDGSVDTEGGRYR
22170|hp|hbo      LQGDVNDPDAT-GVVSVTNRITGDFVLELNEDADDVLRFIRAAREYGK-SEADVEDGQYR
                              **:.:::* ** :: *       :  .:               . .: 

2813|chp|hut      IELVV--GDERIRFEKQTLLVYDDTGQLRRSCSLIPGSVEL
10469|hp|hma      VRLTD-GEGESRTYELRTLLVYDHDGSLLRGQSLIPGGVEL
1169|hp|hhi       VHLTD-GEDESRTYELRTLLVYDPDGSLLRGQSLIPGGVEL
3104|hp|nph       IVIEDEDGTQLDAHKASTLLVYDADGNLLREESLIPSGVEL
1033|hp|hla       VEIDV-DGERLVTYDKHTFLVYDHEGNLLRNESLIPSGVEL
906|hp|nrc1       VEIRV-DGTELVVHEKATFLVYSSDGDLLRGRSLIPSGVEL
1698|hp|hwa       VELYI-EGTEAVVYHKETFLVYDADGKLLRSHSLIPSGVEL
22170|hp|hbo      VEIRTDDDSDTVVYEKRTFLVYDADGNLLRGHSLIPSGVEL
                  : :          .   *:***.  *.* *  ****..***